Galectin 3 (LGALS3) (NM_002306) Human Recombinant Protein

CAT#: TP308785M

Reviews ()
Write a review

Recombinant protein of human lectin, galactoside-binding, soluble, 3 (LGALS3), transcript variant 1

Size: 20 ug 100 ug 1 mg



USD 2,950.00

8 Weeks*

Size
    • 100 ug

Product images

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 412.00


LGALS3 mouse monoclonal antibody,clone 1A1, Biotinylated
    • 100 ul

USD 509.00

Other products for "LGALS3"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC208785 protein sequence
Red=Cloning site Green=Tags(s)

MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAY
PGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKP
NANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFK
VAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 26 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_002297
Locus ID 3958
UniProt ID P17931, A0A024R693
Cytogenetics 14q22.3
Refseq Size 1017
Refseq ORF 750
Synonyms CBP35; GAL3; GALBP; GALIG; L31; LGALS2; MAC2
Summary This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2014]
Protein Families Secreted Protein
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.