Galectin 3 (LGALS3) (NM_002306) Human Recombinant Protein
SKU
TP308785
Recombinant protein of human lectin, galactoside-binding, soluble, 3 (LGALS3), transcript variant 1, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
5 Days*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC208785 protein sequence
Red=Cloning site Green=Tags(s) MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAY PGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKP NANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFK VAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 26 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_002297 |
Locus ID | 3958 |
UniProt ID | P17931 |
Cytogenetics | 14q22.3 |
RefSeq Size | 1017 |
RefSeq ORF | 750 |
Synonyms | CBP35; GAL3; GALBP; GALIG; L31; LGALS2; MAC2 |
Summary | This gene encodes a member of the galectin family of carbohydrate binding proteins. Members of this protein family have an affinity for beta-galactosides. The encoded protein is characterized by an N-terminal proline-rich tandem repeat domain and a single C-terminal carbohydrate recognition domain. This protein can self-associate through the N-terminal domain allowing it to bind to multivalent saccharide ligands. This protein localizes to the extracellular matrix, the cytoplasm and the nucleus. This protein plays a role in numerous cellular functions including apoptosis, innate immunity, cell adhesion and T-cell regulation. The protein exhibits antimicrobial activity against bacteria and fungi. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2014] |
Protein Families | Secreted Protein |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH308785 | LGALS3 MS Standard C13 and N15-labeled recombinant protein (NP_002297) | 10 ug |
$3,255.00
|
|
LC400834 | LGALS3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400834 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 3 (LGALS3), transcript variant 1 | 100 ug |
$436.00
|
|
TP720583 | Purified recombinant protein of Human lectin, galactoside-binding, soluble, 3 (LGALS3), transcript variant 1 | 10 ug |
$185.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.