ITM2C (NM_001012514) Human Recombinant Protein

SKU
TP308687
Recombinant protein of human integral membrane protein 2C (ITM2C), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208687 protein sequence
Red=Cloning site Green=Tags(s)

MVKISFQPAVAGIKGDKADKASASAPAPASATEILLTPARLARDNFFRCGVLYEDSLSSQVRTQMELEED
VKIYLDENYERINVPVPQFGGGDPADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPPRNFWELLMNVK
RGTYLPQTYIIQEEMVVTEHVSDKEALGSFIYHLCNGKDTYRLRRRATRRRINKRGAKNCNAIRHFENTF
VVETLICGVV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001012532
Locus ID 81618
UniProt ID Q9NQX7
Cytogenetics 2q37.1
RefSeq Size 1974
RefSeq ORF 660
Synonyms BRI3; BRICD2C; E25; E25C; ITM3
Summary Negative regulator of amyloid-beta peptide production. May inhibit the processing of APP by blocking its access to alpha- and beta-secretase. Binding to the beta-secretase-cleaved APP C-terminal fragment is negligible, suggesting that ITM2C is a poor gamma-secretase cleavage inhibitor. May play a role in TNF-induced cell death and neuronal differentiation (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:ITM2C (NM_001012514) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308687 ITM2C MS Standard C13 and N15-labeled recombinant protein (NP_001012532) 10 ug
$3,255.00
LC403097 ITM2C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422880 ITM2C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422882 ITM2C HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403097 Transient overexpression lysate of integral membrane protein 2C (ITM2C), transcript variant 1 100 ug
$436.00
LY422880 Transient overexpression lysate of integral membrane protein 2C (ITM2C), transcript variant 3 100 ug
$436.00
LY422882 Transient overexpression lysate of integral membrane protein 2C (ITM2C), transcript variant 2 100 ug
$436.00
TP761803 Purified recombinant protein of Human integral membrane protein 2C (ITM2C), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.