Calprotectin (S100A9) (NM_002965) Human Recombinant Protein

SKU
TP308250
Purified recombinant protein of human S100 calcium binding protein A9 (S100A9), with C-terminal MYC/DDK tag, secretory expressed in HEK293 cells, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208250 protein sequence
Red=Cloning site Green=Tags(s)

MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNA
DKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 13.1 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Cell treatment (PMID: 26933915)
Cell treatment (PMID: 27670158)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002956
Locus ID 6280
UniProt ID P06702
Cytogenetics 1q21.3
RefSeq Size 586
RefSeq ORF 342
Synonyms 60B8AG; CAGB; CFAG; CGLB; L1AG; LIAG; MAC387; MIF; MRP14; NIF; P14
Summary The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis. This antimicrobial protein exhibits antifungal and antibacterial activity. [provided by RefSeq, Nov 2014]
Write Your Own Review
You're reviewing:Calprotectin (S100A9) (NM_002965) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308250 S100A9 MS Standard C13 and N15-labeled recombinant protein (NP_002956) 10 ug
$3,255.00
LC401037 S100A9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401037 Transient overexpression lysate of S100 calcium binding protein A9 (S100A9) 100 ug
$436.00
TP710019 Recombinant protein of human S100 calcium binding protein A9 (S100A9), full length with N-terminal polyhistidine tag, expressed in sf9 cells. 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.