ZFP91 (NM_053023) Human Recombinant Protein

SKU
TP308217
Recombinant protein of human zinc finger protein 91 homolog (mouse) (ZFP91), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>Peptide sequence encoded by RC208217
Blue=ORF Red=Cloning site Green=Tag(s)

GGACRDH*QPRAEGRSGPRPGRCGRRRRSCVPPEEGRVSPPAEEQPQRQASRRPRAAAPGREVPVSSSGQ
EESATPMHRKSNN**RSQGRKRGRRRFCPPSGSFHCCI*T*PGLA***DICFSPS*YREHPKLSVQDRFIAAHLQVR
TKYRPT*L*CWRRASVSRWH**RGRGGGRRDVNQ*RGDTIQR*SKR*DLQTPLRKGNPKATEKIREGKRREGEEGN
*SGSRGGGERRGE*N*RG*GTSKEERKKTKR*QKSTFTQKEKKASNPVCPL*DGRMWNCPCPSSLFAAPH*IPAFA
EEEICMSPSLLWTTLQASEATSATCQTSYRSKGLYL*ILCSGLQEFPQSGSAPDDSHWREAITM*DLWIYL
STKGIS*LAHEET*CRLLLPVFLQYLWQKI*EEGQRSGTQGKKPP*GADCRSSGCQCRRPHHQHRYLGH*PRVP
DAAFRWSGSSSSS*ALGKLNLWRVPTVRS*RDVKVILQWDGTGEPDG*WEDLCGKRQQWRH*RAGYELRYTRC
YHRGSD*RFRLCRT

myc-FLAG tag

Recombinant protein using RC208217 also available, TP308217M
Tag C-Myc/DDK
Predicted MW 63.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_444251
Locus ID 80829
UniProt ID Q96JP5
Cytogenetics 11q12.1
RefSeq Size 5735
RefSeq ORF 1594
Synonyms DMS-8; DSM-8; DSM8; FKSG11; PZF; ZFP-91; ZNF757
Summary The protein encoded by this gene is a member of the zinc finger family of proteins. The gene product contains C2H2-type domains, which are the classical zinc finger domains found in numerous nucleic acid-binding proteins. This protein functions as a regulator of the non-canonical NF-kappaB pathway in lymphotoxin-beta receptor signaling. Alternative splicing results in multiple transcript variants. A read-through transcript variant composed of ZFP91 and the downstream CNTF gene sequence has been identified, but it is thought to be non-coding. Read-through transcription of ZFP91 and CNTF has also been observed in mouse. A ZFP91-related pseudogene has also been identified on chromosome 2. [provided by RefSeq, Oct 2010]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:ZFP91 (NM_053023) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308217 ZFP91 MS Standard C13 and N15-labeled recombinant protein (NP_444251) 10 ug
$3,255.00
LC409325 ZFP91 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409325 Transient overexpression lysate of zinc finger protein 91 homolog (mouse) (ZFP91) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.