SERPINA12 (NM_173850) Human Recombinant Protein

SKU
TP308148
Recombinant protein of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12 (SERPINA12), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208148 protein sequence
Red=Cloning site Green=Tags(s)

MNPTLGLAIFLAVLLTVKGLLKPSFSPRNYKALSEVQGWKQRMAAKELARQNMDLGFKLLKKLAFYNPGR
NIFLSPLSISTAFSMLCLGAQDSTLDEIKQGFNFRKMPEKDLHEGFHYIIHELTQKTQDLKLSIGNTLFI
DQRLQPQRKFLEDAKNFYSAETILTNFQNLEMAQKQINDFISQKTHGKINNLIENIDPGTVMLLANYIFF
RARWKHEFDPNVTKEEDFFLEKNSSVKVPMMFRSGIYQVGYDDKLSCTILEIPYQKNITAIFILPDEGKL
KHLEKGLQVDTFSRWKTLLSRRVVDVSVPRLHMTGTFDLKKTLSYIGVSKIFEEHGDLTKIAPHRSLKVG
EAVHKAELKMDERGTEGAAGTGAQTLPMETPLVVKIDKPYLLLIYSEKIPSVLFLGKIVNPIGK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 47 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_776249
Locus ID 145264
UniProt ID Q8IW75
Cytogenetics 14q32.13
RefSeq Size 2087
RefSeq ORF 1242
Synonyms OL-64
Summary Adipokine that modulates insulin action by specifically inhibiting its target protease KLK7 in white adipose tissues.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Secreted Protein
Write Your Own Review
You're reviewing:SERPINA12 (NM_173850) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308148 SERPINA12 MS Standard C13 and N15-labeled recombinant protein (NP_776249) 10 ug
$3,255.00
LC403567 SERPINA12 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403567 Transient overexpression lysate of serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12 (SERPINA12) 100 ug
$436.00
TP720169 Recombinant protein of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 12 (SERPINA12) 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.