ERG (NM_182918) Human Recombinant Protein

SKU
TP308093
Recombinant protein of human v-ets erythroblastosis virus E26 oncogene homolog (avian) (ERG), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208093 representing NM_182918
Red=Cloning site Green=Tags(s)

MASTIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQPPARVTIKMEC
NPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVR
QWLEWAVKEYGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDK
ALQNSPRLMHARNTGGAAFIFPNTSVYPEATQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTV
PKTEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARR
WGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGS
YHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPSHLGTYY

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 53.7 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Varying amounts of human ERG expressed in HEK293 cells was incubated for one hour with wild-type or mutant biotinylated oligonucleotide (1 pmole/ul) in the presence of 25 ug/ml poly dI:dC. The reaction mixture was subsequently transferred to a microplate containing 2500 Luminex beads coupled with anti-ERG monoclonal antibody 2G8. The ERG-oligo complexes were captured onto the antibody-coated beads for two hours at room temperature with shaking. The beads were then washed, and the biotin was detected with streptavidin-phycoerythrin for 30 minutes. The beads were washed again and the fluorescent intensity was read in the Luminex instrument. The wild-type oligonucleotide carried ACCGGAAGT consensus binding sequence while the mutant oligonucleotide was identical except for a 2-base mutation in the consensus binding region, ACCCCAAGT
ELISA capture for autoantibodies (PMID: 28191285)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_891548
Locus ID 2078
UniProt ID P11308
Cytogenetics 21q22.2
RefSeq Size 3055
RefSeq ORF 1437
Synonyms erg-3; p55
Summary This gene encodes a member of the erythroblast transformation-specific (ETS) family of transcriptions factors. All members of this family are key regulators of embryonic development, cell proliferation, differentiation, angiogenesis, inflammation, and apoptosis. The protein encoded by this gene is mainly expressed in the nucleus. It contains an ETS DNA-binding domain and a PNT (pointed) domain which is implicated in the self-association of chimeric oncoproteins. This protein is required for platelet adhesion to the subendothelium, inducing vascular cell remodeling. It also regulates hematopoesis, and the differentiation and maturation of megakaryocytic cells. This gene is involved in chromosomal translocations, resulting in different fusion gene products, such as TMPSSR2-ERG and NDRG1-ERG in prostate cancer, EWS-ERG in Ewing's sarcoma and FUS-ERG in acute myeloid leukemia. More than two dozens of transcript variants generated from combinatorial usage of three alternative promoters and multiple alternative splicing events have been reported, but the full-length nature of many of these variants has not been determined. [provided by RefSeq, Apr 2014]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:ERG (NM_182918) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308093 ERG MS Standard C13 and N15-labeled recombinant protein (NP_891548) 10 ug
$3,255.00
PH318892 ERG MS Standard C13 and N15-labeled recombinant protein (NP_004440) 10 ug
$3,255.00
LC401413 ERG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403650 ERG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427827 ERG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401413 Transient overexpression lysate of v-ets erythroblastosis virus E26 oncogene homolog (avian) (ERG), transcript variant 2 100 ug
$665.00
LY403650 Transient overexpression lysate of v-ets erythroblastosis virus E26 oncogene homolog (avian) (ERG), transcript variant 1 100 ug
$436.00
LY427827 Transient overexpression lysate of v-ets erythroblastosis virus E26 oncogene homolog (avian) (ERG), transcript variant 3 100 ug
$436.00
TP318892 Recombinant protein of human v-ets erythroblastosis virus E26 oncogene homolog (avian) (ERG), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.