OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

USP20 (NM_006676) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308051
Recombinant protein of human ubiquitin specific peptidase 20 (USP20), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA342571 Rabbit Polyclonal Anti-USP20 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "USP20 or NM_006676"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208051 protein sequence
Red=Cloning site Green=Tags(s)

MGDSRDLCPHLDSIGEVTKEDLLLKSKGTCQSCGVTGPNLWACLQVACPYVGCGESFADHSTIHAQAKKH
NLTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESEDDDLK
PRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVP
TSLSHGIKLVNPMFRGYAQQDTQEFLRCLMDQLHEELKEPVVATVALTEARDSDSSDTDEKREGDRSPSE
DEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDADV
DTAMAALDQPAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPSY
VLKKAQVLSAGSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIPGKEDLAKLHSA
IYQNVPAKPGACGDSYAAQGWLAFIVEYIRRFVVSCTPSWFWGPVVTLEDCLAAFFAADELKGDNMYSCE
RCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKINSHVSFPLEGLDLRPFLAKECTSQITTYDLLS
VICHHGTAGSGHYIAYCQNVINGQWYEFDDQYVTEVHETVVQNAEGYVLFYRKSSEEAMRERQQVVSLAA
MREPSLLRFYVSREWLNKFNTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGGG
PAVNHLYVCSICQVEIEALAKRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPPG
PIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYGGGPEIAIRQSVAQPLGPENLHGEQKIEAET
RAV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 101.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Pull-down assay (PMID: 26839314)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006667
Locus ID 10868
UniProt ID Q9Y2K6
Cytogenetics 9q34.11
RefSeq Size 4538
RefSeq ORF 2739
Synonyms hVDU2; LSFR3A; VDU2
Summary This gene encodes a ubiquitin specific processing protease that was first identified as a substrate of the VHL (von Hippel-Lindau disease) protein E3 ubiquitin ligase complex. In addition to being ubiquitinated by the VHL-E3 ligase complex, this enzyme deubiquitinates hypoxia-inducible factor (HIF)-1 alpha and thereby causes increased expression of HIF-1alpha targeted genes which play a role in angiogenesis, glucose metabolism, cell proliferation and metastasis. The enzyme encoded by this gene also regulates G-protein coupled receptor signaling by mediating the deubiquitination of beta-2 adrenergic receptor (ADRB2). This enzyme is a ubiquitously expressed thiolester hydrolase. Alternative splicing results in multiple transcript variants encoding the same protein. provided by RefSeq, Jan 2013
Protein Categories Enzyme: Peptidases, Intracellular Proteins
Protein Families Druggable Genome, Protease
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "USP20" proteins (5)
SKU Description Size Price
PH308051 USP20 MS Standard C13 and N15-labeled recombinant protein (NP_006667) 10 ug
$3,360.00
LC402002 Lyophilized USP20 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC423335 Lyophilized USP20 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402002 Transient overexpression lysate of ubiquitin specific peptidase 20 (USP20), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY423335 Transient overexpression lysate of ubiquitin specific peptidase 20 (USP20), transcript variant 2 (as WB positive control) 100 ug
$665.00

file-alt Citations

Ubiquitin-specific protease 20 Regulates the Reciprocal Functions of Beta-arrestin2 in Toll-like Receptor 4-promoted NFkappaB Activation
Jean-Charles, Zhang, Wu et al
J. Biol. Chem. (2016)
AI Summary: OriGene products, specifically the C-terminal MYC/DDK-tagged recombinant human TRAF6 (TP319528) and human USP20 (TP308051), were used as purified proteins in protein interaction studies to investigate the regulatory role of USP20 and β-arrestin2 in TLR4-mediated NFκB activation.
Snippet: Purified Proteins—C-terminal MYC/DDK- tagged recombinant human TRAF6 (TP319528) and C-terminal MYC/DDK-tagged human USP20 (TP308051) were purchased from OriGene Technologies, Inc. Both proteins were supplied at >80% purity. ... Cite SaveSaving
JBC Papers in Press. Published on February 2, 2016 as Manuscript M115. 687129
Jean-Charles, Zhang, Wu et al
Journal of Biological Chemistry (2016) 291 (14)
AI Summary: OriGene products, specifically the C-terminal MYC/DDK-tagged recombinant human TRAF6 (TP319528) and human USP20 (TP308051), were used as purified proteins in the study to facilitate experimental analysis.
Snippet: Purified Proteins—C-terminal MYC/DDK- tagged recombinant human TRAF6 (TP319528) and C-terminal MYC/DDK-tagged human USP20 (TP308051) were purchased from OriGene Technologies, Inc. Both proteins were supplied at >80% purity. ... Cite SaveSaving
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products