MAST4 (NM_198828) Human Recombinant Protein

SKU TP307706L

Recombinant protein of human microtubule associated serine/threonine kinase family member 4 (MAST4), transcript variant 2, 1 mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC207706 representing NM_198828; Red=Cloning site Green=Tags(s); ; MGEKVSEAPEPVPRGCSGHGSRTPASALVAASSPGASSAESSSGSETLSEEGEPGGFSREHQPPPPPPLG; GTLGARAPAAWAPASVLLERGVLALPPPLPGGAVPPAPRGSSASQEEQDEELDHILSPPPMPFRKCSNPD; VASGPGKSLKYKRQLSEDGRQLRRGSLGGALTGRYLLPNPVAGQAWPASAETSNLVRMRSQALGQSAPSL; TASLKELSLPRRGSLIDSQKWNCLVKRPVCPNAGRTSPLG; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_942123
• Locus ID: 375449
• UniProt ID: O15021
• Cytogenetics: 5q12.3
• RefSeq Size: 1105
• RefSeq ORF: 750
• Summary: This gene encodes a member of the microtubule-associated serine/threonine protein kinases. The proteins in this family contain a domain that gives the kinase the ability to determine its own scaffold to control the effects of their kinase activities. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2014]
• Protein Families: Druggable Genome, Protein Kinase