FSIP1 (NM_152597) Human Recombinant Protein

SKU
TP307399
Recombinant protein of human fibrous sheath interacting protein 1 (FSIP1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC207399 protein sequence
Red=Cloning site Green=Tags(s)

MDIIKGNLDGISKPASNSRIRPGSRSSNASLEVLSTEPGSFKVDTASNLNSGKEDHSESSNTENRRTSND
DKQESCSEKIKLAEEGSDEDLDLVQHQIISECSDEPKLKELDSQLQDAIQKMKKLDKILAKKQRREKEIK
KQGLEMRIKLWEEIKSAKYSEAWQSKEEMENTKKFLSLTAVSEETVGPSHEEEDTFSSVFHTQIPPEEYE
MQMQKLNKDFTCDVERNESLIKSGKKPFSNTEKIELRGKHNQDFIKRNIELAKESRNPVVMVDREKKRLV
ELLKDLDEKDSGLSSSEGDQSGWVVPVKGYELAVTQHQQLAEIDIKLQELSAASPTISSFSPRLENRNNQ
KPDHDGERNMEVTPGEKILRNTKEQRDLHNRLREIDEKLKMMKENVLESTSRLSEEQLKCLLDECILKQK
SIIKLSSERKKEDIEDVTPVFPQLSRSIISKLLNESETKVQKTEVEDADMLESEECEASKGYYLTKALTG
HNMSEALVTEAENMKCLQFSKDVIISDTKDYFMSKTLGIGRLKRPSFLDDPLYGISVSLSSEDQHLKLSS
PENTIADEQETKDAAEECKEP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 65.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_689810
Locus ID 161835
UniProt ID Q8NA03
Cytogenetics 15q14
RefSeq Size 2813
RefSeq ORF 1743
Synonyms HSD10
Write Your Own Review
You're reviewing:FSIP1 (NM_152597) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH307399 FSIP1 MS Standard C13 and N15-labeled recombinant protein (NP_689810) 10 ug
$3,255.00
LC407403 FSIP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407403 Transient overexpression lysate of fibrous sheath interacting protein 1 (FSIP1) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.