DNTTIP1 (NM_052951) Human Recombinant Protein

SKU
TP306867
Recombinant protein of human deoxynucleotidyltransferase, terminal, interacting protein 1 (DNTTIP1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206867 representing NM_052951
Red=Cloning site Green=Tags(s)

MGATGDAEQPRGPSGAERGGLELGDAGAAGQLVLTNPWNIMIKHRQVQRRGRRSQMTTSFTDPAISMDLL
RAVLQPSINEEIQTVFNKYMKFFQKAALNVRDNVGEEVDAEQLIQEACRSCLEQAKLLFSDGEKVIPRLT
HELPGIKRGRQAEEECAHRGSPLPKKRKGRPPGHILSSDRAAAGMVWKPKSCEPIRREGPKWDPARLNES
TTFVLGSRANKALGMGGTRGRIYIKHPHLFKYAADPQDKHWLAEQHHMRATGGKMAYLLIEEDIRDLAAS
DDYRGCLDLKLEELKSFVLPSWMVEKMRKYMETLRTENEHRAVEAPPQT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 36.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_443183
Locus ID 116092
UniProt ID Q9H147
Cytogenetics 20q13.12
RefSeq Size 1317
RefSeq ORF 987
Synonyms C20orf167; dJ447F3.4; Tdif1
Summary DNTTIP1 binds DNA and enhances the activity of terminal deoxynucleotidyltransferase (TDT, or DNTT; MIM 187410), a DNA polymerase that catalyzes the polymerization of DNA in the absence of a DNA template (Yamashita et al., 2001 [PubMed 11473582]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:DNTTIP1 (NM_052951) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306867 DNTTIP1 MS Standard C13 and N15-labeled recombinant protein (NP_443183) 10 ug
$3,255.00
LC403275 DNTTIP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403275 Transient overexpression lysate of deoxynucleotidyltransferase, terminal, interacting protein 1 (DNTTIP1) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.