DNTTIP1 (NM_052951) Human Mass Spec Standard

SKU
PH306867
DNTTIP1 MS Standard C13 and N15-labeled recombinant protein (NP_443183)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206867]
Predicted MW 36.8 kDa
Protein Sequence
Protein Sequence
>RC206867 representing NM_052951
Red=Cloning site Green=Tags(s)

MGATGDAEQPRGPSGAERGGLELGDAGAAGQLVLTNPWNIMIKHRQVQRRGRRSQMTTSFTDPAISMDLL
RAVLQPSINEEIQTVFNKYMKFFQKAALNVRDNVGEEVDAEQLIQEACRSCLEQAKLLFSDGEKVIPRLT
HELPGIKRGRQAEEECAHRGSPLPKKRKGRPPGHILSSDRAAAGMVWKPKSCEPIRREGPKWDPARLNES
TTFVLGSRANKALGMGGTRGRIYIKHPHLFKYAADPQDKHWLAEQHHMRATGGKMAYLLIEEDIRDLAAS
DDYRGCLDLKLEELKSFVLPSWMVEKMRKYMETLRTENEHRAVEAPPQT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_443183
RefSeq Size 1317
RefSeq ORF 987
Synonyms C20orf167; dJ447F3.4; Tdif1
Locus ID 116092
UniProt ID Q9H147
Cytogenetics 20q13.12
Summary DNTTIP1 binds DNA and enhances the activity of terminal deoxynucleotidyltransferase (TDT, or DNTT; MIM 187410), a DNA polymerase that catalyzes the polymerization of DNA in the absence of a DNA template (Yamashita et al., 2001 [PubMed 11473582]).[supplied by OMIM, Mar 2008]
Write Your Own Review
You're reviewing:DNTTIP1 (NM_052951) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC403275 DNTTIP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403275 Transient overexpression lysate of deoxynucleotidyltransferase, terminal, interacting protein 1 (DNTTIP1) 100 ug
$436.00
TP306867 Recombinant protein of human deoxynucleotidyltransferase, terminal, interacting protein 1 (DNTTIP1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.