Ornithine Decarboxylase (ODC1) (NM_002539) Human Recombinant Protein

SKU
TP306858
Recombinant protein of human ornithine decarboxylase 1 (ODC1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206858 protein sequence
Red=Cloning site Green=Tags(s)

MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKC
NDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELM
KVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQ
AISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYV
ASAFTLAVNIIAKKIVLKEQTGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKY
YSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQF
QNPDFPPEVEEQDASTLPVSCAWESGMKRHRAACASASINV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 51 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Enzyme activity (PMID: 27257787)
Enzyme activity (PMID: 28346093)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002530
Locus ID 4953
UniProt ID P11926
Cytogenetics 2p25.1
RefSeq Size 2307
RefSeq ORF 1383
Synonyms BABS; NEDBA; NEDBIA; ODC
Summary This gene encodes the rate-limiting enzyme of the polyamine biosynthesis pathway which catalyzes ornithine to putrescine. The activity level for the enzyme varies in response to growth-promoting stimuli and exhibits a high turnover rate in comparison to other mammalian proteins. Originally localized to both chromosomes 2 and 7, the gene encoding this enzyme has been determined to be located on 2p25, with a pseudogene located on 7q31-qter. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Dec 2013]
Protein Families Druggable Genome
Protein Pathways Arginine and proline metabolism, Glutathione metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:Ornithine Decarboxylase (ODC1) (NM_002539) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306858 ODC1 MS Standard C13 and N15-labeled recombinant protein (NP_002530) 10 ug
$3,255.00
LC400909 ODC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400909 Transient overexpression lysate of ornithine decarboxylase 1 (ODC1) 100 ug
$436.00
TP721016 Purified recombinant protein of Human ornithine decarboxylase 1 (ODC1) 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.