Ornithine Decarboxylase (ODC1) (NM_002539) Human Mass Spec Standard

SKU
PH306858
ODC1 MS Standard C13 and N15-labeled recombinant protein (NP_002530)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206858]
Predicted MW 51.1 kDa
Protein Sequence
Protein Sequence
>RC206858 protein sequence
Red=Cloning site Green=Tags(s)

MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKC
NDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELM
KVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQ
AISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYV
ASAFTLAVNIIAKKIVLKEQTGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKY
YSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQF
QNPDFPPEVEEQDASTLPVSCAWESGMKRHRAACASASINV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002530
RefSeq Size 2307
RefSeq ORF 1383
Synonyms BABS; NEDBA; NEDBIA; ODC
Locus ID 4953
UniProt ID P11926
Cytogenetics 2p25.1
Summary This gene encodes the rate-limiting enzyme of the polyamine biosynthesis pathway which catalyzes ornithine to putrescine. The activity level for the enzyme varies in response to growth-promoting stimuli and exhibits a high turnover rate in comparison to other mammalian proteins. Originally localized to both chromosomes 2 and 7, the gene encoding this enzyme has been determined to be located on 2p25, with a pseudogene located on 7q31-qter. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Dec 2013]
Protein Families Druggable Genome
Protein Pathways Arginine and proline metabolism, Glutathione metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:Ornithine Decarboxylase (ODC1) (NM_002539) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400909 ODC1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400909 Transient overexpression lysate of ornithine decarboxylase 1 (ODC1) 100 ug
$436.00
TP306858 Recombinant protein of human ornithine decarboxylase 1 (ODC1), 20 µg 20 ug
$737.00
TP721016 Purified recombinant protein of Human ornithine decarboxylase 1 (ODC1) 10 ug
$265.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.