Ephexin 1 (NGEF) (NM_019850) Human Recombinant Protein

SKU
TP306775
Recombinant protein of human neuronal guanine nucleotide exchange factor (NGEF), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206775 protein sequence
Red=Cloning site Green=Tags(s)

METRESEDLEKTRRKSASDQWNTDNEPAKVKPELLPEKEETSQADQDIQDKEPHCHIPIKRNSIFNRSIR
RKSKAKARDNPERNASCLADSQDNGKSVNEPLTLNIPWSRTPPCRTAMQTDPGAQEMSESSSTPGNGATP
EEWPALADSPTTLTEALRMIHPIPADSWRNLIEQIGLLYQEYRDKSTLQEIETRRQQDAEIEDNTNGSPA
SEDTPEEEEEEEEEEEPASPPERKTLPQICLLSNPHSRFNLWQDLPEIRSSGVLEILQPEEIKLQEAMFE
LVTSEASYYKSLNLLVSHFMENERIRKILHPSEAHILFSNVLDVLAVSERFLLELEHRMEENIVISDVCD
IVYRYAADHFSVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLELDPKCRGLPFSSFLILPFQRITRLK
LLVQNILKRVEERSERECTALDAHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKIKSVPIISHSRWL
LKQGELQQMSGPKTSRTLRTKKLFHEIYLFLFNDLLVICRQIPGDKYQVFDSAPRGLLRVEELEDQGQTL
ANVFILRLLENADDREATYMLKASSQSEMKRWMTSLAPNRRTKFVSFTSRLLDCPQVQCVHPYVAQQPDE
LTLELADILNILDKTDDGWIFGERLHDQERGWFPSSMTEEILNPKIRSQNLKECFRVHKMDDPQRSQNKD
RRKLGSRNRQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 82.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_062824
Locus ID 25791
UniProt ID Q8N5V2
Cytogenetics 2q37.1
RefSeq Size 3184
RefSeq ORF 2130
Synonyms ARHGEF27; EPHEXIN
Summary Acts as a guanine nucleotide exchange factor (GEF) which differentially activates the GTPases RHOA, RAC1 and CDC42. Plays a role in axon guidance regulating ephrin-induced growth cone collapse and dendritic spine morphogenesis. Upon activation by ephrin through EPHA4, the GEF activity switches toward RHOA resulting in its activation. Activated RHOA promotes cone retraction at the expense of RAC1- and CDC42-stimulated growth cone extension (By similarity).[UniProtKB/Swiss-Prot Function]
Protein Pathways Axon guidance
Write Your Own Review
You're reviewing:Ephexin 1 (NGEF) (NM_019850) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306775 NGEF MS Standard C13 and N15-labeled recombinant protein (NP_062824) 10 ug
$3,255.00
LC412718 NGEF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426444 NGEF HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412718 Transient overexpression lysate of neuronal guanine nucleotide exchange factor (NGEF), transcript variant 1 100 ug
$436.00
LY426444 Transient overexpression lysate of neuronal guanine nucleotide exchange factor (NGEF), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.