CCDC172 (NM_198515) Human Recombinant Protein

SKU
TP306700
Recombinant protein of human chromosome 10 open reading frame 96 (C10orf96), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206700 protein sequence
Red=Cloning site Green=Tags(s)

MSLESLFQHIIFTEHQAEESRRLMREVRSEITRCREKIKKATEELNEEKIKLESKVQQFFEKSFFLQLLK
AHENALEKQYSEITNHRNMLLQTFEAIKKQMIEEEDKFIKEITDFNNDYEITKKRELLMKENVKIEISDL
ENQANMLKSEMKSMEHDSSQLNELQKQKSELIQELFTLQRKLKVFEDEENESICTTKYLEAEKIKISEKP
QNDTECLRLKKELELYKEDDMESVYEALQTEIEFLELTLAQKDLQESK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 30.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_940917
Locus ID 374355
UniProt ID P0C7W6
Cytogenetics 10q25.3
RefSeq Size 1703
RefSeq ORF 774
Synonyms C10orf96
Write Your Own Review
You're reviewing:CCDC172 (NM_198515) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306700 C10orf96 MS Standard C13 and N15-labeled recombinant protein (NP_940917) 10 ug
$3,255.00
LC404901 CCDC172 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404901 Transient overexpression lysate of chromosome 10 open reading frame 96 (C10orf96) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.