SAP30BP (NM_013260) Human Recombinant Protein

SKU
TP306462
Recombinant protein of human SAP30 binding protein (SAP30BP), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206462 protein sequence
Red=Cloning site Green=Tags(s)

MAGKKNVLSSLAVYAEDSEPESDGEAGIEAVGSAAEEKGGLVSDAYGEDDFSRLGGDEDGYEEEEDENSR
QSEDDDSETEKPEADDPKDNTEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYE
RKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDK
LEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPA
VVTVTTSASGSKTTVISAVGTIVKKAKQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 33.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_037392
Locus ID 29115
UniProt ID Q9UHR5
Cytogenetics 17q25.1
RefSeq Size 2758
RefSeq ORF 924
Synonyms HCNGP; HTRG; HTRP
Summary Induces cell death. May act as a transcriptional corepressor of a gene related to cell survival. May be involved in the regulation of beta-2-microglobulin genes.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SAP30BP (NM_013260) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306462 SAP30BP MS Standard C13 and N15-labeled recombinant protein (NP_037392) 10 ug
$3,255.00
LC415705 SAP30BP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415705 Transient overexpression lysate of SAP30 binding protein (SAP30BP) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.