Doublecortin (DCX) (NM_178153) Human Recombinant Protein

SKU
TP306454
Recombinant protein of human doublecortin (DCX), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206454 protein sequence
Red=Cloning site Green=Tags(s)

MELDFGHFDERDKTSRNMRGSRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVY
AVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTK
NVNPNWSVNVKTSANMKAPQSLASSNSAQARENKDFVRPKLVTIIRSGVKPRKAVRVLLNKKTAHSFEQV
LTDITEAIKLETGVVKKLYTLDGKQVTCLHDFFGDDDVFIACGPEKFRYAQDDFSLDENECRVMKGNPSA
TAGPKASPTPQKTSAKSPGPMRRSKSPADSANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSL
DDSDSLGDSM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 39.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_835366
Locus ID 1641
UniProt ID O43602
Cytogenetics Xq23
RefSeq Size 9135
RefSeq ORF 1080
Synonyms DBCN; DC; LISX; SCLH; XLIS
Summary This gene encodes a member of the doublecortin family. The protein encoded by this gene is a cytoplasmic protein and contains two doublecortin domains, which bind microtubules. In the developing cortex, cortical neurons must migrate over long distances to reach the site of their final differentiation. The encoded protein appears to direct neuronal migration by regulating the organization and stability of microtubules. In addition, the encoded protein interacts with LIS1, the regulatory gamma subunit of platelet activating factor acetylhydrolase, and this interaction is important to proper microtubule function in the developing cortex. Mutations in this gene cause abnormal migration of neurons during development and disrupt the layering of the cortex, leading to epilepsy, cognitive disability, subcortical band heterotopia ("double cortex" syndrome) in females and lissencephaly ("smooth brain" syndrome) in males. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2010]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:Doublecortin (DCX) (NM_178153) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306454 DCX MS Standard C13 and N15-labeled recombinant protein (NP_835366) 10 ug
$3,255.00
PH316349 DCX MS Standard C13 and N15-labeled recombinant protein (NP_835364) 10 ug
$3,255.00
PH321891 DCX MS Standard C13 and N15-labeled recombinant protein (NP_835365) 10 ug
$3,255.00
LC403598 DCX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405947 DCX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406000 DCX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424646 DCX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434187 DCX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403598 Transient overexpression lysate of doublecortin (DCX), transcript variant 2 100 ug
$436.00
LY405947 Transient overexpression lysate of doublecortin (DCX), transcript variant 4 100 ug
$436.00
LY406000 Transient overexpression lysate of doublecortin (DCX), transcript variant 3 100 ug
$436.00
LY424646 Transient overexpression lysate of doublecortin (DCX), transcript variant 1 100 ug
$665.00
LY434187 Transient overexpression lysate of doublecortin (DCX), transcript variant 5 100 ug
$436.00
TP316349 Recombinant protein of human doublecortin (DCX), transcript variant 4, 20 µg 20 ug
$737.00
TP321891 Recombinant protein of human doublecortin (DCX), transcript variant 2, 20 µg 20 ug
$737.00
TP331188 Purified recombinant protein of Homo sapiens doublecortin (DCX), transcript variant 5, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.