CD16 (FCGR3A) (NM_000569) Human Recombinant Protein

SKU
TP306429
Recombinant protein of human Fc fragment of IgG, low affinity IIIa, receptor (CD16a) (FCGR3A), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206429 representing NM_000569
Red=Cloning site Green=Tags(s)

MGGGAGERLFTSSCLVGLVPLGLRISLVTCPLQCGIMWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQW
YRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEV
HIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRG
LVGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHK
FKWRKDPQDK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 27.2 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000560
Locus ID 2214
UniProt ID P08637
Cytogenetics 1q23.3
RefSeq Size 2406
RefSeq ORF 870
Synonyms CD16; CD16A; FCG3; FCGR3; FCGRIII; FCR-10; FCRIII; FCRIIIA; IGFR3; IMD20
Summary This gene encodes a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other responses, including antibody dependent cellular mediated cytotoxicity and antibody dependent enhancement of virus infections. This gene (FCGR3A) is highly similar to another nearby gene (FCGR3B) located on chromosome 1. The receptor encoded by this gene is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene are associated with immunodeficiency 20, and have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2020]
Protein Families ES Cell Differentiation/IPS, Secreted Protein, Transmembrane
Protein Pathways Fc gamma R-mediated phagocytosis, Natural killer cell mediated cytotoxicity, Systemic lupus erythematosus
Write Your Own Review
You're reviewing:CD16 (FCGR3A) (NM_000569) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306429 FCGR3A MS Standard C13 and N15-labeled recombinant protein (NP_000560) 10 ug
$3,255.00
LC400194 FCGR3A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426815 FCGR3A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426817 FCGR3A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400194 Transient overexpression lysate of Fc fragment of IgG, low affinity IIIa, receptor (CD16a) (FCGR3A), transcript variant 1 100 ug
$436.00
LY426815 Transient overexpression lysate of Fc fragment of IgG, low affinity IIIa, receptor (CD16a) (FCGR3A), transcript variant 3 100 ug
$436.00
LY426817 Transient overexpression lysate of Fc fragment of IgG, low affinity IIIa, receptor (CD16a) (FCGR3A), transcript variant 5 100 ug
$436.00
TP721246 Human CD16a Protein (C-His-Avi, 176V) 25 ug
$300.00
TP721247 Biotinylated Human CD16a Protein (C-His-Avi, 176V) 25 ug
$430.00
TP721248 PE Conjugated Human CD16a Protein (C-His, 176V) 25 ug
$430.00
TP721249 APC Conjugated Human CD16a Protein (C-His, 176V) 25 ug
$430.00
TP723977 Human FCGR3A Protein, His Tag 100 ug
$565.00
TP762433 Purified recombinant protein of Human Fc fragment of IgG, low affinity IIIa, receptor (CD16a) (FCGR3A), transcript variant 3, Leu13-Gln208, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$226.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.