CD16 (FCGR3A) (NM_000569) Human Recombinant Protein
CAT#: TP306429
Recombinant protein of human Fc fragment of IgG, low affinity IIIa, receptor (CD16a) (FCGR3A), transcript variant 1, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206429 representing NM_000569
Red=Cloning site Green=Tags(s) MGGGAGERLFTSSCLVGLVPLGLRISLVTCPLQCGIMWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQW YRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEV HIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRG LVGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHK FKWRKDPQDK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.2 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000560 |
Locus ID | 2214 |
UniProt ID | P08637, M9MML0 |
Cytogenetics | 1q23.3 |
Refseq Size | 2406 |
Refseq ORF | 870 |
Synonyms | CD16; CD16A; FCG3; FCGR3; FCGRIII; FCR-10; FCRIII; FCRIIIA; IGFR3; IMD20 |
Summary | This gene encodes a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other responses, including antibody dependent cellular mediated cytotoxicity and antibody dependent enhancement of virus infections. This gene (FCGR3A) is highly similar to another nearby gene (FCGR3B) located on chromosome 1. The receptor encoded by this gene is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene are associated with immunodeficiency 20, and have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2020] |
Protein Families | ES Cell Differentiation/IPS, Secreted Protein, Transmembrane |
Protein Pathways | Fc gamma R-mediated phagocytosis, Natural killer cell mediated cytotoxicity, Systemic lupus erythematosus |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400194 | FCGR3A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC426815 | FCGR3A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC426817 | FCGR3A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400194 | Transient overexpression lysate of Fc fragment of IgG, low affinity IIIa, receptor (CD16a) (FCGR3A), transcript variant 1 |
USD 436.00 |
|
LY426815 | Transient overexpression lysate of Fc fragment of IgG, low affinity IIIa, receptor (CD16a) (FCGR3A), transcript variant 3 |
USD 436.00 |
|
LY426817 | Transient overexpression lysate of Fc fragment of IgG, low affinity IIIa, receptor (CD16a) (FCGR3A), transcript variant 5 |
USD 436.00 |
|
PH306429 | FCGR3A MS Standard C13 and N15-labeled recombinant protein (NP_000560) |
USD 3,255.00 |
|
TP721246 | Human CD16a Protein (C-His-Avi, 176V) |
USD 258.00 |
|
TP721247 | Biotinylated Human CD16a Protein (C-His-Avi, 176V) |
USD 366.00 |
|
TP721248 | PE Conjugated Human CD16a Protein (C-His, 176V) |
USD 366.00 |
|
TP721249 | APC Conjugated Human CD16a Protein (C-His, 176V) |
USD 366.00 |
|
TP723977 | Human FCGR3A Protein, His Tag |
USD 495.00 |
|
TP762433 | Purified recombinant protein of Human Fc fragment of IgG, low affinity IIIa, receptor (CD16a) (FCGR3A), transcript variant 3, Leu13-Gln208, with N-terminal His tag, expressed in E.coli, 50ug |
USD 226.00 |
{0} Product Review(s)
Be the first one to submit a review