Synaptotagmin 4 (SYT4) (NM_020783) Human Recombinant Protein

SKU
TP306304
Recombinant protein of human synaptotagmin IV (SYT4), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206304 protein sequence
Red=Cloning site Green=Tags(s)

MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSK
KKFGADDKNEVKNKPAVPKNSLHLDLEKRDLNGNFPKTNLKPGSPSDLENATPKLFLEGEKESVSPESLK
SSTSLTSEEKQEKLGTLFFSLEYNFERKAFVVNIKEARGLPAMDEQSMTSDPYIKMTILPEKKHKVKTRV
LRKTLDPAFDETFTFYGIPYTQIQELALHFTILSFDRFSRDDIIGEVLIPLSGIELSEGKMLMNREIIKR
NVRKSSGRGELLISLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTP
NAVFNELFVFDIPCEGLEDISVEFLVLDSERGSRNEVIGQLVLGAAAEGTGGEHWKEICDYPRRQIAKWH
VLCDG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 47.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_065834
Locus ID 6860
UniProt ID Q9H2B2
Cytogenetics 18q12.3
RefSeq Size 4111
RefSeq ORF 1275
Synonyms HsT1192
Summary May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (By similarity). Plays a role in dendrite formation by melanocytes (PubMed:23999003).[UniProtKB/Swiss-Prot Function]
Protein Families Secreted Protein, Transmembrane
Write Your Own Review
You're reviewing:Synaptotagmin 4 (SYT4) (NM_020783) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306304 SYT4 MS Standard C13 and N15-labeled recombinant protein (NP_065834) 10 ug
$3,255.00
LC412338 SYT4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412338 Transient overexpression lysate of synaptotagmin IV (SYT4) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.