RAB11FIP5 (NM_015470) Human Recombinant Protein

SKU
TP306173
Recombinant protein of human RAB11 family interacting protein 5 (class I) (RAB11FIP5), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206173 representing NM_015470
Red=Cloning site Green=Tags(s)

MALVRGAEPAAGPSRWLPTHVQVTVLRARGLRGKSSGAGSTSDAYTVIQVGREKYSTSVVEKTHGCPEWR
EECSFELPPGALDGLLRAQEADAGPAPWAASSAAACELVLTTMHRSLIGVDKFLGQATVALDEVFGAGRA
QHTQWYKLHSKPGKKEKERGEIEVTIQFTRNNLSAMFDLSMKDKPRSPFSKIRDKMKGKKKYDLESASAI
LPSSAIEDPDLGSLGKMGKAKGFFLRNKLRKSSLTQSNTSLGSDSTLSSASGSLAYQGPGAELLTRSPSR
SSWLSTEGGRDSAQSPKLFTHKRTYSDEANQMRVAPPRALLDLQGHLDAASRSSLCVNGSHIYNEEPQGP
VRHRSSISGSLPSSGSLQAVSSRFSEEGPRSTDDTWPRGSRSNSSSEAVLGQEELSAQAKVLAPGASHPG
EEEGARLPEGKPVQVATPIVASSEAVAEKEGARKEERKPRMGLFHHHHQGLSRSELGRRSSLGEKGGPIL
GASPHHSSSGEGKAKSSWFGLREAKDPTQKPSPHPVKPLSAAPVEGSPDRKQSRSSLSIALSSGLEKLKT
VTSGSIQPVTQAPQAGQMVDTKRLKDSAVLDQSAKYYNLTHDELISLLLQRERELSQRDEHVQELESYID
RLLVRIMETSPTLLQIPPGPPK

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 70.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_056285
Locus ID 26056
UniProt ID Q9BXF6
Cytogenetics 2p13.2
RefSeq Size 4340
RefSeq ORF 1956
Synonyms gaf-1; GAF1; pp75; rab11-FIP5; RIP11
Summary Rab effector involved in protein trafficking from apical recycling endosomes to the apical plasma membrane. Involved in insulin granule exocytosis. May regulate V-ATPase intracellular transport in response to extracellular acidosis.[UniProtKB/Swiss-Prot Function]
Protein Pathways Endocytosis
Write Your Own Review
You're reviewing:RAB11FIP5 (NM_015470) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306173 RAB11FIP5 MS Standard C13 and N15-labeled recombinant protein (NP_056285) 10 ug
$3,255.00
LC414522 RAB11FIP5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414522 Transient overexpression lysate of RAB11 family interacting protein 5 (class I) (RAB11FIP5) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.