PLBD2 (NM_173542) Human Recombinant Protein

SKU
TP306135
Purified recombinant protein of Homo sapiens phospholipase B domain containing 2 (PLBD2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206135 protein sequence
Red=Cloning site Green=Tags(s)

MVGQMYCYPGSHLARALTRALALALVLALLVGPFLSGLAGAIPAPGGRWARDGQVPPASRSRSVLLDVSA
GQLLMVDGRHPDAVAWANLTNAIRETGWAFLELGTSGQYNDSLQAYAAGVVEAAVSEELIYMHWMNTVVN
YCGPFEYEVGYCERLKSFLEANLEWMQEEMESNPDSPYWHQVRLTLLQLKGLEDSYEGRVSFPAGKFTIK
PLGFLLLQLSGDLEDLELALNKTKIKPSLGSGSCSALIKLLPGQSDLLVAHNTWNNYQHMLRVIKKYWLQ
FREGPWGDYPLVPGNKLVFSSYPGTIFSCDDFYILGSGLVTLETTIGNKNPALWKYVRPRGCVLEWVRNI
VANRLASDGATWADIFKRFNSGTYNNQWMIVDYKAFIPGGPSPGSRVLTILEQIPGMVVVADKTSELYQK
TYWASYNIPSFETVFNASGLQALVAQYGDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYNDFLHDPLS
LCKACNPQPNGENAISARSDLNPANGSYPFKALRQRSHGGIDVKVTSMSLARILSLLAASGPTWDQVPPF
QWSTSPFSGLLHMGQPDLWKFAPVKVSWD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 61.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_775813
Locus ID 196463
UniProt ID Q8NHP8
Cytogenetics 12q24.13
RefSeq Size 2832
RefSeq ORF 1767
Synonyms P76
Summary Putative phospholipase.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:PLBD2 (NM_173542) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306135 PLBD2 MS Standard C13 and N15-labeled recombinant protein (NP_775813) 10 ug
$3,255.00
LC431479 PLBD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY431479 Transient overexpression lysate of phospholipase B domain containing 2 (PLBD2), transcript variant 2 100 ug
$436.00
TP701044 Purified recombinant protein of Human phospholipase B domain containing 2 (PLBD2), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug 50 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.