PLBD2 (NM_173542) Human Recombinant Protein

CAT#: TP306135

Purified recombinant protein of Homo sapiens phospholipase B domain containing 2 (PLBD2), 20 µg

Size: 20 ug 100 ug 1 mg


  View other "PLBD2" proteins (4)

Special Offer: 30% off this product. Use code: "Pro30".

USD 867.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "PLBD2"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC206135 protein sequence
Red=Cloning site Green=Tags(s)

MVGQMYCYPGSHLARALTRALALALVLALLVGPFLSGLAGAIPAPGGRWARDGQVPPASRSRSVLLDVSA
GQLLMVDGRHPDAVAWANLTNAIRETGWAFLELGTSGQYNDSLQAYAAGVVEAAVSEELIYMHWMNTVVN
YCGPFEYEVGYCERLKSFLEANLEWMQEEMESNPDSPYWHQVRLTLLQLKGLEDSYEGRVSFPAGKFTIK
PLGFLLLQLSGDLEDLELALNKTKIKPSLGSGSCSALIKLLPGQSDLLVAHNTWNNYQHMLRVIKKYWLQ
FREGPWGDYPLVPGNKLVFSSYPGTIFSCDDFYILGSGLVTLETTIGNKNPALWKYVRPRGCVLEWVRNI
VANRLASDGATWADIFKRFNSGTYNNQWMIVDYKAFIPGGPSPGSRVLTILEQIPGMVVVADKTSELYQK
TYWASYNIPSFETVFNASGLQALVAQYGDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYNDFLHDPLS
LCKACNPQPNGENAISARSDLNPANGSYPFKALRQRSHGGIDVKVTSMSLARILSLLAASGPTWDQVPPF
QWSTSPFSGLLHMGQPDLWKFAPVKVSWD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 61.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_775813
Locus ID 196463
UniProt ID Q8NHP8
Cytogenetics 12q24.13
Refseq Size 2832
Refseq ORF 1767
Synonyms P76
Summary Putative phospholipase.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.