PLBD2 (NM_173542) Human Mass Spec Standard

SKU
PH306135
PLBD2 MS Standard C13 and N15-labeled recombinant protein (NP_775813)
$3,255.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC206135]
Predicted MW 65.5 kDa
Protein Sequence
Protein Sequence
>RC206135 protein sequence
Red=Cloning site Green=Tags(s)

MVGQMYCYPGSHLARALTRALALALVLALLVGPFLSGLAGAIPAPGGRWARDGQVPPASRSRSVLLDVSA
GQLLMVDGRHPDAVAWANLTNAIRETGWAFLELGTSGQYNDSLQAYAAGVVEAAVSEELIYMHWMNTVVN
YCGPFEYEVGYCERLKSFLEANLEWMQEEMESNPDSPYWHQVRLTLLQLKGLEDSYEGRVSFPAGKFTIK
PLGFLLLQLSGDLEDLELALNKTKIKPSLGSGSCSALIKLLPGQSDLLVAHNTWNNYQHMLRVIKKYWLQ
FREGPWGDYPLVPGNKLVFSSYPGTIFSCDDFYILGSGLVTLETTIGNKNPALWKYVRPRGCVLEWVRNI
VANRLASDGATWADIFKRFNSGTYNNQWMIVDYKAFIPGGPSPGSRVLTILEQIPGMVVVADKTSELYQK
TYWASYNIPSFETVFNASGLQALVAQYGDWFSYDGSPRAQIFRRNQSLVQDMDSMVRLMRYNDFLHDPLS
LCKACNPQPNGENAISARSDLNPANGSYPFKALRQRSHGGIDVKVTSMSLARILSLLAASGPTWDQVPPF
QWSTSPFSGLLHMGQPDLWKFAPVKVSWD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_775813
RefSeq Size 2832
RefSeq ORF 1767
Synonyms P76
Locus ID 196463
UniProt ID Q8NHP8
Cytogenetics 12q24.13
Summary Putative phospholipase.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:PLBD2 (NM_173542) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC431479 PLBD2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY431479 Transient overexpression lysate of phospholipase B domain containing 2 (PLBD2), transcript variant 2 100 ug
$436.00
TP306135 Purified recombinant protein of Homo sapiens phospholipase B domain containing 2 (PLBD2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP701044 Purified recombinant protein of Human phospholipase B domain containing 2 (PLBD2), with C-terminal His tag, secretory expressed in HEK293 cells, 50ug 50 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.