Cyclophilin 40 (PPID) (NM_005038) Human Recombinant Protein

SKU
TP306039M
Recombinant protein of human peptidylprolyl isomerase D (PPID), 100 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$1,918.00 MSRP $2,950.00 MSRP $2,950.00
6 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC206039 protein sequence
Red=Cloning site Green=Tags(s)

MSHPSPQAKPSNPSNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGHTTGKPLHFKG
CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGRNTNGSQFFITTVPTP
HLDGKHVVFGQVIKGIGVARILENVEVKGEKPAKLCVIAECGELKEGDDGGIFPKDGSGDSHPDFPEDAD
IDLKDVDKILLITEDLKNIGNTFFKSQNWEMAIKKYAEVLRYVDSSKAVIETADRAKLQPIALSCVLNIG
ACKLKMSNWQGAIDSCLEALELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQGIAPEDKAIQAELLKV
KQKIKAQKDKEKAVYAKMFA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 40.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005029
Locus ID 5481
UniProt ID Q08752
Cytogenetics 4q32.1
RefSeq Size 1851
RefSeq ORF 1110
Synonyms CYP-40; CYPD
Summary The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein has been shown to possess PPIase activity and, similar to other family members, can bind to the immunosuppressant cyclosporin A. [provided by RefSeq, Jul 2008]
Protein Families Stem cell - Pluripotency
Protein Pathways Calcium signaling pathway, Huntington's disease, Parkinson's disease
Write Your Own Review
You're reviewing:Cyclophilin 40 (PPID) (NM_005038) Human Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.