CRYZL1 (NM_145858) Human Recombinant Protein

SKU
TP305953
Recombinant protein of human crystallin, zeta (quinone reductase)-like 1 (CRYZL1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205953 protein sequence
Red=Cloning site Green=Tags(s)

MKGLYFQQSSTDEEITFVFQEKEDLPVTEDNFVKLQVKACALSQINTKLLAEMKMKKDLFPVGREIAGIV
LDVGSKVSFFQPDDEVVGILPLDSEDPGLCEVVRVHEHYLVHKPEKVTWTEAAGSIRDGVRAYTALHYLS
HLSPGKSVLIMDGASAFGTIAIQLAHHRGAKVISTACSLEDKQCLERFRPPIARVIDVSNGKVHVAESCL
EETGGLGVDIVLDAGVRLYSKDDEPAVKLQLLPHKHDIITLLGVGGHWVTTEENLQLDPPDSHCLFLKGA
TLAFLNDEVWNLSNVQQGKYLCILKDVMEKLSTGVFRPQLDEPIPLYEAKVSMEAVQKNQGRKKQVVQF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 38.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_665857
Locus ID 9946
UniProt ID O95825
Cytogenetics 21q22.11
RefSeq Size 1726
RefSeq ORF 1047
Synonyms 4P11; QOH-1
Summary This gene encodes a protein that has sequence similarity to zeta crystallin, also known as quinone oxidoreductase. This zeta crystallin-like protein also contains an NAD(P)H binding site. Alternatively spliced transcript variants have been observed but their full-length nature has not been completely determined. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:CRYZL1 (NM_145858) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305953 CRYZL1 MS Standard C13 and N15-labeled recombinant protein (NP_665857) 10 ug
$3,255.00
LC407853 CRYZL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY407853 Transient overexpression lysate of crystallin, zeta (quinone reductase)-like 1 (CRYZL1) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.