ABHD12B (NM_181533) Human Recombinant Protein

SKU
TP305792
Recombinant protein of human abhydrolase domain containing 12B (ABHD12B), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205792 protein sequence
Red=Cloning site Green=Tags(s)

MLGIWHTVPSCRGEDAKGKDCCWYEAALRDGNPIIVYLHGSAEHRAASHRLKLVKVLSDGGFHVLSVDYR
GFGDSTGKPTEEGLTTDAICVYEWTKARSGITPVCLWGHSLGTGVATNAAKVLEEKGCPVDAIVLEAPFT
NMWVASINYPLLKIYRNIPGFLRTLMDALRKDKIIFPNDENVKFLSSPLLILHGEDDRTVPLEYGKKLYE
IARNAYRNKERVKMVIFPPGFQHNLLCKSPTLLITVRDFLSKQWS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 28.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_853511
Locus ID 145447
UniProt ID Q7Z5M8
Cytogenetics 14q22.1
RefSeq Size 1580
RefSeq ORF 765
Synonyms BEM46L3; C14orf29; c14_5314
Write Your Own Review
You're reviewing:ABHD12B (NM_181533) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305792 ABHD12B MS Standard C13 and N15-labeled recombinant protein (NP_853511) 10 ug
$3,255.00
LC405695 ABHD12B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405695 Transient overexpression lysate of abhydrolase domain containing 12B (ABHD12B), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.