BRUNOL6 (CELF6) (NM_052840) Human Recombinant Protein

SKU
TP305606
Recombinant protein of human bruno-like 6, RNA binding protein (Drosophila) (BRUNOL6), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205606 protein sequence
Red=Cloning site Green=Tags(s)

MTAAPGGSAQPAGPGPRLGFSTADSGVGMSGLNPGPAVPMKDHDAIKLFVGQIPRGLDEQDLKPLFEEFG
RIYELTVLKDRLTGLHKGCAFLTYCARDSALKAQSALHEQKTLPGMNRPIQVKPAASEGRGEDRKLFVGM
LGKQQGEEDVRRLFQPFGHIEECTVLRSPDGTSKGCAFVKFGSQGEAQAAIRGLHGSRTMAGASSSLVVK
LADTDRERALRRMQQMAGHLGAFHPAPLPLGACGAYTTAILQHQAALLAAAQGPGLGPVAAVAAQMQHVA
AFSLVAAPLLPAAAANSPPGSGPGTLPGLPAPIGVNGFGPLTPQTNGQPGSDTLYNNGLSPYPAQSPGVA
DPLQQAYAGMHHYAAAYPSAYAPVSTAFPQQPSALPQQQREGPEGCNLFIYHLPQEFGDAELIQTFLPFG
AVVSAKVFVDRATNQSKCFGFVSFDNPTSAQTAIQAMNGFQIGMKRLKAQLKRPKDANRPY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 50.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_443072
Locus ID 60677
UniProt ID Q96J87
Cytogenetics 15q23
RefSeq Size 3418
RefSeq ORF 1443
Synonyms BRUNOL6
Summary Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Multiple alternatively spliced transcript variants encoding different isoforms have been identified in this gene. [provided by RefSeq, Feb 2010]
Write Your Own Review
You're reviewing:BRUNOL6 (CELF6) (NM_052840) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305606 CELF6 MS Standard C13 and N15-labeled recombinant protein (NP_443072) 10 ug
$3,255.00
LC409451 CELF6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433113 CELF6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409451 Transient overexpression lysate of bruno-like 6, RNA binding protein (Drosophila) (BRUNOL6) 100 ug
$436.00
LY433113 Transient overexpression lysate of CUGBP, Elav-like family member 6 (CELF6), transcript variant 2 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.