N6AMT2 (EEF1AKMT1) (NM_174928) Human Recombinant Protein

SKU
TP305604
Recombinant protein of human N-6 adenine-specific DNA methyltransferase 2 (putative) (N6AMT2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205604 protein sequence
Red=Cloning site Green=Tags(s)

MSDLEDDETPQLSAHALAALQEFYAEQKQQIEPGEDDKYNIGIIEENWQLSQFWYSQETALQLAQEAIAA
VGEGGRIACVSAPSVYQKLRELCRENFSIYIFEYDKRFAMYGEEFIFYDYNNPLDLPERIAAHSFDIVIA
DPPYLSEECLRKTSETVKYLTRGKILLCTGAIMEEQAAELLGVKMCTFVPRHTRNLANEFRCYVNYDSGL
DCGI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_777588
Locus ID 221143
UniProt ID Q8WVE0
Cytogenetics 13q12.11
RefSeq Size 890
RefSeq ORF 642
Synonyms ESP13; N6AMT2
Summary Protein-lysine methyltransferase that selectively catalyzes the trimethylation of EEF1A at 'Lys-79'.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:N6AMT2 (EEF1AKMT1) (NM_174928) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305604 N6AMT2 MS Standard C13 and N15-labeled recombinant protein (NP_777588) 10 ug
$3,255.00
LC406409 N6AMT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406409 Transient overexpression lysate of N-6 adenine-specific DNA methyltransferase 2 (putative) (N6AMT2) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.