TSGA10 (NM_025244) Human Recombinant Protein

SKU
TP305528
Recombinant protein of human testis specific, 10 (TSGA10), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205528 protein sequence
Red=Cloning site Green=Tags(s)

MMRSRSKSPRRPSPTARGANCDVELLKTTTRDREELKCMLEKYERHLAEIQGNVKVLKSERDKIFLLYEQ
AQEEITRLRREMMKSCKSPKSTTAHAILRRVETERDVAFTDLRRMTTERDSLRERLKIAQETAFNEKAHL
EQRIEELECTVHNLDDERMEQMSNMTLMKETISTVEKEMKSLARKAMDTESELGRQKAENNSLRLLYENT
EKDLSDTQRHLAKKKYELQLTQEKIMCLDEKIDNFTRQNIAQREEISILGGTLNDLAKEKECMQACLDKK
SENIASLGESLAMKEKTISGMKNIIAEMEQASRQCTEALIVCEQDVSRMRRQLDETNDELAQIARERDIL
AHDNDNLQEQFAKAKQENQALSKKLNDTHNELNDIKQKVQDTNLEVNKLKNILKSEESENRQMMEQLRKA
NEDAENWENKARQSEADNNTLKLELITAEAEGNRLKEKVDSLNREVEQHLNAERSYKSQISTLHKSVVKM
EEELQKVQFEKVSALADLSSTRELCIKLDSSKELLNRQLVAKDQEIEMRENELDSAHSEIELLRSQMANE
RISMQNLEALLVANRDKEYQSQIALQEKESEIQLLKEHLCLAENKMAIQSRDVAQFRNVVTQLEADLDIT
KRQLGTERFERERAVQELRRQNYSSNAYHMSSTMKPNTKCHSPERAHHRSPDRGLDRSLEENLCYRDF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 81.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_079520
Locus ID 80705
UniProt ID Q9BZW7
Cytogenetics 2q11.2
RefSeq Size 3685
RefSeq ORF 2094
Synonyms CEP4L; CT79; SPGF26
Summary Plays a role in spermatogenesis (PubMed:28905369). When overexpressed, prevents nuclear localization of HIF1A (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:TSGA10 (NM_025244) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305528 TSGA10 MS Standard C13 and N15-labeled recombinant protein (NP_079520) 10 ug
$3,255.00
LC405325 TSGA10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC410806 TSGA10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY405325 Transient overexpression lysate of testis specific, 10 (TSGA10), transcript variant 2 100 ug
$665.00
LY410806 Transient overexpression lysate of testis specific, 10 (TSGA10), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.