SRRP35 (SRSF12) (NM_080743) Human Recombinant Protein

SKU
TP305472
Recombinant protein of human serine-arginine repressor protein (35 kDa) (SRrp35), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205472 protein sequence
Red=Cloning site Green=Tags(s)

MSRYTRPPNTSLFIRNVADATRPEDLRREFGRYGPIVDVYIPLDFYTRRPRGFAYVQFEDVRGAEDALYN
LNRKWVCGRQIEIQFAQGDRKTPGQMKSKERHPCSPSDHRRSRSPSQRRTRSRSSSWGRNRRRSDSLKES
RHRRFSYSKSKSRSKSLPRRSTSARQSRTPRRNFGSRGRSRSKSLQKRSKSIGKSQSSSPQKQTSSGTKS
RSHGRHSDSIARSPCKSPKGYTNSETKVQTAKHSHFRSHSRSRSYRHKNSW

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 30.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_542781
Locus ID 135295
UniProt ID Q8WXF0
Cytogenetics 6q15
RefSeq Size 3628
RefSeq ORF 783
Synonyms SFRS13B; SFRS19; SRrp35
Summary Splicing factor that seems to antagonize SR proteins in pre-mRNA splicing regulation.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SRRP35 (SRSF12) (NM_080743) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305472 SFRS13B MS Standard C13 and N15-labeled recombinant protein (NP_542781) 10 ug
$3,255.00
LC409060 SRSF12 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409060 Transient overexpression lysate of splicing factor, arginine/serine-rich 13B (SFRS13B) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.