OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SLC30A3 (NM_003459) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP305310
Recombinant protein of human solute carrier family 30 (zinc transporter), member 3 (SLC30A3), 20 µg
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA501498 Anti-SLC30A3 mouse monoclonal antibody, clone OTI2H6 (formerly 2H6)
100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SLC30A3 or NM_003459"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205310 protein sequence
Red=Cloning site Green=Tags(s)

MEPSPAAGGLETTRLVSPRDRGGAGGSLRLKSLFTEPSEPLPEESKPVEMPFHHCHRDPLPPPGLTPERL
HARRQLYAACAVCFVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSLFSLWLSTRPATRTMTFGWHR
SETLGALASVVSLWMVTGILLYLAFVRLLHSDYHIEGGAMLLTASIAVCANLLMAFVLHQAGPPHSHGSR
GAEYAPLEEGPEEPLPLGNTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKAADPISTFLFSICALGS
TAPTLRDVLRILMEGTPRNVGFEPVRDTLLSVPGVRATHELHLWALTLTYHVASAHLAIDSTADPEAVLA
EASSRLYSRFGFSSCTLQVEQYQPEMAQCLRCQEPPQA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 41.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003450
Locus ID 7781
UniProt ID Q99726
Cytogenetics 2p23.3
RefSeq Size 2108
RefSeq ORF 1164
Synonyms ZNT3
Summary Involved in accumulation of zinc in synaptic vesicles.UniProtKB/Swiss-Prot Function
Protein Categories Membrane Proteins
Protein Families Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SLC30A3" proteins (3)
SKU Description Size Price
PH305310 SLC30A3 MS Standard C13 and N15-labeled recombinant protein (NP_003450) 10 ug
$3,360.00
LC401170 Lyophilized SLC30A3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401170 Transient overexpression lysate of solute carrier family 30 (zinc transporter), member 3 (SLC30A3) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products