C20orf141 (NM_080739) Human Recombinant Protein

SKU
TP305215
Recombinant protein of human chromosome 20 open reading frame 141 (C20orf141), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205215 protein sequence
Red=Cloning site Green=Tags(s)

MTRLCLPRPEAREDPIPVPPRGLGAGEGSGSPVRPPVSTWGPSWAQLLDSVLWLGALGLTIQAVFSTTGP
ALLLLLVSFLTFDLLHRPAGHTLPQRKLLTRGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALLLLLMG
LGPLLRACGMPLTLLGLAFCLHPWA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 17.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_542777
Locus ID 128653
UniProt ID Q9NUB4
Cytogenetics 20p13
RefSeq Size 741
RefSeq ORF 495
Synonyms dJ860F19.4
Write Your Own Review
You're reviewing:C20orf141 (NM_080739) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305215 C20orf141 MS Standard C13 and N15-labeled recombinant protein (NP_542777) 10 ug
$3,255.00
LC409056 C20orf141 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409056 Transient overexpression lysate of chromosome 20 open reading frame 141 (C20orf141) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.