LIM domain only 3 (LMO3) (NM_018640) Human Recombinant Protein

SKU TP305190M

Recombinant protein of human LIM domain only 3 (rhombotin-like 2) (LMO3), transcript variant 1, 100 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205190 protein sequence; Red=Cloning site Green=Tags(s); ; MLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRL; FGVTGNCAACSKLIPAFEMVMRAKDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQTDYEEGLMKEGY; APQVR; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_061110
• Locus ID: 55885
• UniProt ID: Q8TAP4
• Cytogenetics: 12p12.3
• RefSeq Size: 3850
• RefSeq ORF: 435
• Synonyms: RBTN3; RBTNL2; Rhom-3; RHOM3
• Summary: The protein encoded by this gene belongs to the rhombotin family of cysteine-rich LIM domain oncogenes. This gene is predominantly expressed in the brain. Related family members, LMO1 and LMO2 on chromosome 11, have been reported to be involved in chromosomal translocations in T-cell leukemia. Many alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Aug 2011]
• Protein Families: Transcription Factors