TCPTP (PTPN2) (NM_080423) Human Recombinant Protein

SKU
TP305090
Recombinant protein of human protein tyrosine phosphatase, non-receptor type 2 (PTPN2), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC205090 protein sequence
Red=Cloning site Green=Tags(s)

MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVKLQNAENDYIN
ASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKESVKCAQYWPTDDQEMLFKETG
FSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTWPDFGVPESPASFLNFLFKVRESGSLNPDHG
PAVIHCSAGIGRSGTFSLVDTCLVLMEKGDDINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIK
GDSSIQKRWKELSKEDLSPAFDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSERPRL
TDT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 40.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_536348
Locus ID 5771
UniProt ID P17706
Cytogenetics 18p11.21
RefSeq Size 1619
RefSeq ORF 1059
Synonyms PTN2; PTPT; TC-PTP; TCELLPTP; TCPTP
Summary The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. Members of the PTP family share a highly conserved catalytic motif, which is essential for the catalytic activity. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. Epidermal growth factor receptor and the adaptor protein Shc were reported to be substrates of this PTP, which suggested the roles in growth factor mediated cell signaling. Multiple alternatively spliced transcript variants encoding different isoforms have been found. Two highly related but distinctly processed pseudogenes that localize to chromosomes 1 and 13, respectively, have been reported. [provided by RefSeq, May 2011]
Protein Families Druggable Genome, Phosphatase, Transmembrane
Write Your Own Review
You're reviewing:TCPTP (PTPN2) (NM_080423) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH305090 PTPN2 MS Standard C13 and N15-labeled recombinant protein (NP_536348) 10 ug
$3,255.00
LC409168 PTPN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC419088 PTPN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409168 Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 2 (PTPN2), transcript variant 3 100 ug
$436.00
LY419088 Transient overexpression lysate of protein tyrosine phosphatase, non-receptor type 2 (PTPN2), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.