LOX 1 (OLR1) (NM_002543) Human Recombinant Protein
SKU
TP304704
Recombinant protein of human oxidized low density lipoprotein (lectin-like) receptor 1 (OLR1), 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC204704 protein sequence
Red=Cloning site Green=Tags(s) MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQE QANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANC SAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRN PSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 30.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | Binding assay (PMID: 28377266) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_002534 |
Locus ID | 4973 |
UniProt ID | P78380 |
Cytogenetics | 12p13.2 |
RefSeq Size | 2533 |
RefSeq ORF | 819 |
Synonyms | CLEC8A; LOX1; LOXIN; SCARE1; SLOX1 |
Summary | This gene encodes a low density lipoprotein receptor that belongs to the C-type lectin superfamily. This gene is regulated through the cyclic AMP signaling pathway. The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein. This protein may be involved in the regulation of Fas-induced apoptosis. This protein may play a role as a scavenger receptor. Mutations of this gene have been associated with atherosclerosis, risk of myocardial infarction, and may modify the risk of Alzheimer's disease. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Feb 2010] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | PPAR signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH304704 | OLR1 MS Standard C13 and N15-labeled recombinant protein (NP_002534) | 10 ug |
$3,255.00
|
|
LC400904 | OLR1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC432642 | OLR1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400904 | Transient overexpression lysate of oxidized low density lipoprotein (lectin-like) receptor 1 (OLR1) | 100 ug |
$436.00
|
|
LY432642 | Transient overexpression lysate of oxidized low density lipoprotein (lectin-like) receptor 1 (OLR1), transcript variant 2 | 100 ug |
$436.00
|
|
TP720433 | Recombinant protein of human oxidized low density lipoprotein (lectin-like) receptor 1 (OLR1), transcript variant 2. | 10 ug |
$230.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.