LOX 1 (OLR1) (NM_002543) Human Recombinant Protein

SKU
TP304704
Recombinant protein of human oxidized low density lipoprotein (lectin-like) receptor 1 (OLR1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204704 protein sequence
Red=Cloning site Green=Tags(s)

MTFDDLKIQTVKDQPDEKSNGKKAKGLQFLYSPWWCLAAATLGVLCLGLVVTIMVLGMQLSQVSDLLTQE
QANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANC
SAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRN
PSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 30.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Binding assay (PMID: 28377266)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002534
Locus ID 4973
UniProt ID P78380
Cytogenetics 12p13.2
RefSeq Size 2533
RefSeq ORF 819
Synonyms CLEC8A; LOX1; LOXIN; SCARE1; SLOX1
Summary This gene encodes a low density lipoprotein receptor that belongs to the C-type lectin superfamily. This gene is regulated through the cyclic AMP signaling pathway. The encoded protein binds, internalizes and degrades oxidized low-density lipoprotein. This protein may be involved in the regulation of Fas-induced apoptosis. This protein may play a role as a scavenger receptor. Mutations of this gene have been associated with atherosclerosis, risk of myocardial infarction, and may modify the risk of Alzheimer's disease. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Feb 2010]
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways PPAR signaling pathway
Write Your Own Review
You're reviewing:LOX 1 (OLR1) (NM_002543) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304704 OLR1 MS Standard C13 and N15-labeled recombinant protein (NP_002534) 10 ug
$3,255.00
LC400904 OLR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432642 OLR1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400904 Transient overexpression lysate of oxidized low density lipoprotein (lectin-like) receptor 1 (OLR1) 100 ug
$436.00
LY432642 Transient overexpression lysate of oxidized low density lipoprotein (lectin-like) receptor 1 (OLR1), transcript variant 2 100 ug
$436.00
TP720433 Recombinant protein of human oxidized low density lipoprotein (lectin-like) receptor 1 (OLR1), transcript variant 2. 10 ug
$230.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.