Aquaporin 4 (AQP4) (NM_001650) Human Recombinant Protein

SKU TP304693L

Purified recombinant protein of Human aquaporin 4 (AQP4), transcript variant a, full-length, with C-terminal Myc-DDK tag, expressed in HEK293T cells, 1mg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204693 representing NM_001650; Red=Cloning site Green=Tags(s); ; MSDRPTARRWGKCGPLCTRENIMVAFKGVWTQAFWKAVTAEFLAMLIFVLLSLGSTINWGGTEKPLPVDM; VLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYIAAQCLGAIIGAGILYLVTPPS; VVGGLGVTMVHGNLTAGHGLLVELIITFQLVFTIFASCDSKRTDVTGSIALAIGFSVAIGHLFAINYTGA; SMNPARSFGPAVIMGNWENHWIYWVGPIIGAVLAGGLYEYVFCPDVEFKRRFKEAFSKAAQQTKGSYMEV; EDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.6 kDa
• Concentration: >50 ug/mL as determined by Microplate Bradford Protein Assay method
• Purity: > 90% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, and 10% glycerol, pH 7.3
• Stability: Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001641
• Locus ID: 361
• UniProt ID: P55087 F1DSG4 P55087-1
• Cytogenetics: 18q11.2
• RefSeq Size: 5216
• RefSeq ORF: 969
• Synonyms: MIWC; WCH4
• Summary: This gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selective channels in the plasma membranes of many cells. This protein is the predominant aquaporin found in brain and has an important role in brain water homeostasis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. Additional isoforms, resulting from the use of alternative in-frame translation initiation codons, have also been described. Recent studies provided evidence for translational readthrough in this gene, and expression of C-terminally extended isoforms via the use of an alternative in-frame translation termination codon. [provided by RefSeq, Jun 2018]
• Protein Families: Druggable Genome, Transmembrane