BAFF (TNFSF13B) (NM_006573) Human Recombinant Protein

SKU
TP304672
Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204672 protein sequence
Red=Cloning site Green=Tags(s)

MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGKLLAATLLLALLSCCLTVVSFYQVA
ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEE
TVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGH
LIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFG
ALKLL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 31 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006564
Locus ID 10673
UniProt ID Q9Y275
Cytogenetics 13q33.3
RefSeq Size 2675
RefSeq ORF 855
Synonyms BAFF; BLYS; CD257; DTL; TALL-1; TALL1; THANK; TNFSF20; TNLG7A; ZTNF4
Summary The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR. This cytokine is expressed in B cell lineage cells, and acts as a potent B cell activator. It has been also shown to play an important role in the proliferation and differentiation of B cells. Alternatively spliced transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Mar 2011]
Protein Families Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction
Write Your Own Review
You're reviewing:BAFF (TNFSF13B) (NM_006573) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304672 TNFSF13B MS Standard C13 and N15-labeled recombinant protein (NP_006564) 10 ug
$3,255.00
LC401966 TNFSF13B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401966 Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 1 100 ug
$436.00
TP700008 Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 1, secreted soluble form with N-terminal His tag, expressed in human cells 20 ug
$867.00
TP723963 Human BAFF Protein, hFc Tag 100 ug
$650.00
TP750018 Recombinant protein of human soluble BAFF (TNFSF13B) produced in E. coli. 100 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.