GIMAP4 (NM_018326) Human Recombinant Protein
CAT#: TP304653
Recombinant protein of human GTPase, IMAP family member 4 (GIMAP4), 20 µg
View other "GIMAP4" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204653 protein sequence
Red=Cloning site Green=Tags(s) MAAQYGSMSFNPSTPGASYGPGRQEPRNSQLRIVLVGKTGAGKSATGNSILGRKVFHSGTAAKSITKKCE KRSSSWKETELVVVDTPGIFDTEVPNAETSKEIIRCILLTSPGPHALLLVVPLGRYTEEEHKATEKILKM FGERARSFMILIFTRKDDLGDTNLHDYLREAPEDIQDLMDIFGDRYCALNNKATGAEQEAQRAQLLGLIQ RVVRENKEGCYTNRMYQRAEEEIQKQTQAMQELHRVELEREKARIREEYEEKIRKLEDKVEQEKRKKQME KKLAEQEAHYAVRQQRARTEVESKDGILELIMTALQIASFILLRLFAED myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060796 |
Locus ID | 55303 |
UniProt ID | Q9NUV9, A0A090N7X0 |
Cytogenetics | 7q36.1 |
Refseq Size | 1983 |
Refseq ORF | 987 |
Synonyms | IAN-1; IAN1; IMAP4; MSTP062 |
Summary | This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. The encoded protein of this gene may be negatively regulated by T-cell acute lymphocytic leukemia 1 (TAL1). In humans, the IAN subfamily genes are located in a cluster at 7q36.1. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413123 | GIMAP4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY413123 | Transient overexpression lysate of GTPase, IMAP family member 4 (GIMAP4) |
USD 436.00 |
|
PH304653 | GIMAP4 MS Standard C13 and N15-labeled recombinant protein (NP_060796) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review