GIMAP4 (NM_018326) Human Mass Spec Standard

SKU
PH304653
GIMAP4 MS Standard C13 and N15-labeled recombinant protein (NP_060796)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204653]
Predicted MW 37.5 kDa
Protein Sequence
Protein Sequence
>RC204653 protein sequence
Red=Cloning site Green=Tags(s)

MAAQYGSMSFNPSTPGASYGPGRQEPRNSQLRIVLVGKTGAGKSATGNSILGRKVFHSGTAAKSITKKCE
KRSSSWKETELVVVDTPGIFDTEVPNAETSKEIIRCILLTSPGPHALLLVVPLGRYTEEEHKATEKILKM
FGERARSFMILIFTRKDDLGDTNLHDYLREAPEDIQDLMDIFGDRYCALNNKATGAEQEAQRAQLLGLIQ
RVVRENKEGCYTNRMYQRAEEEIQKQTQAMQELHRVELEREKARIREEYEEKIRKLEDKVEQEKRKKQME
KKLAEQEAHYAVRQQRARTEVESKDGILELIMTALQIASFILLRLFAED

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060796
RefSeq Size 1983
RefSeq ORF 987
Synonyms IAN-1; IAN1; IMAP4; MSTP062
Locus ID 55303
UniProt ID Q9NUV9
Cytogenetics 7q36.1
Summary This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. The encoded protein of this gene may be negatively regulated by T-cell acute lymphocytic leukemia 1 (TAL1). In humans, the IAN subfamily genes are located in a cluster at 7q36.1. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:GIMAP4 (NM_018326) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413123 GIMAP4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413123 Transient overexpression lysate of GTPase, IMAP family member 4 (GIMAP4) 100 ug
$436.00
TP304653 Recombinant protein of human GTPase, IMAP family member 4 (GIMAP4), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.