OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CTRP6 (C1QTNF6) (NM_031910) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP304524
Recombinant protein of human C1q and tumor necrosis factor related protein 6 (C1QTNF6), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA306238 Rabbit Polyclonal CTRP6 Antibody
100 ug
$640.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CTRP6 or NM_031910"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204524 protein sequence
Red=Cloning site Green=Tags(s)

MQWLRVRESPGEATGHRVTMVTAALGPVWAALLLFLLMCEIPMVELTFDRAVASGCQRCCDSEDPLDPAH
VSSASSSGRPHALPEIRPYINITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGSKGDKGEMGSPGAPCQ
KRFFAFSVGRKTALHSGEDFQTLLFERVFVNLDGCFDMATGQFAAPLRGIYFFSLNVHSWNYKETYVHIM
HNQKEAVILYAQPSERSIMQSQSVMLDLAYGDRVWVRLFKRQRENAIYSNDFDTYITFSGHLIKAEDD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 30.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_114116
Locus ID 114904
UniProt ID Q9BXI9
Cytogenetics 22q12.3
RefSeq Size 2954
RefSeq ORF 834
Synonyms CTFP6; CTRP6; ZACRP6
Protein Categories Intracellular Proteins, Secreated Proteins
Protein Families Secreted Protein, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CTRP6" proteins (5)
SKU Description Size Price
PH304524 C1QTNF6 MS Standard C13 and N15-labeled recombinant protein (NP_114116) 10 ug
$3,360.00
LC403130 Lyophilized C1QTNF6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405547 Lyophilized C1QTNF6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403130 Transient overexpression lysate of C1q and tumor necrosis factor related protein 6 (C1QTNF6), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY405547 Transient overexpression lysate of C1q and tumor necrosis factor related protein 6 (C1QTNF6), transcript variant 2 (as WB positive control) 100 ug
$436.00

file-alt Citations

C1q/TNF-Related Protein 6 Is a Pattern Recognition Molecule That Recruits Collectin-11 from the Complement System to Ligands
Kirketerp-Møller, Bayarri-Olmos, Krogfelt et al
J. Immunol. (2020)
Cited by 24
AI Summary: OriGene’s commercially available CTRP6 protein was used as a calibrator in an in-house sandwich ELISA to quantify CTRP6 concentrations in this study.
Snippet: with elution buffer and dialyzed against TBS + 2.5 mM CaCl2 and stored in aliquots at 280˚C. The concentration of CTRP6 in the supernatant and elution fractions was calculated with an in-house sandwich ELISA using commercially available CTRP6 (Origene) as calibrator
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products