GAGE7 (NM_021123) Human Recombinant Protein

SKU TP304459M

Purified recombinant protein of Human G antigen 7 (GAGE7), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 100 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204459 protein sequence; Red=Cloning site Green=Tags(s); ; MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGP; KPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC; ; myc-FLAG tag
• Tag: Myc-DDK
• Predicted MW: 12.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_066946
• Locus ID: 2579
• UniProt ID: O76087 P0CL80 P0CL81 P0CL82
• Cytogenetics: Xp11.4-p11.2
• RefSeq Size: 498
• RefSeq ORF: 351
• Synonyms: AL4; CT4.7; GAGE-7