BAX (NM_138761) Human Recombinant Protein

SKU
TP304369
Purified recombinant protein of Homo sapiens BCL2-associated X protein (BAX), transcript variant alpha, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204369 representing NM_138761
Red=Cloning site Green=Tags(s)

MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDEL
DSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWT
LDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 21 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_620116
Locus ID 581
UniProt ID Q07812
Cytogenetics 19q13.33
RefSeq Size 888
RefSeq ORF 576
Synonyms BCL2L4
Summary The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. The association and the ratio of BAX to BCL2 also determines survival or death of a cell following an apoptotic stimulus. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene. [provided by RefSeq, Dec 2019]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Amyotrophic lateral sclerosis (ALS), Apoptosis, Colorectal cancer, Huntington's disease, Neurotrophin signaling pathway, p53 signaling pathway, Pathways in cancer, Prion diseases
Write Your Own Review
You're reviewing:BAX (NM_138761) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304369 BAX MS Standard C13 and N15-labeled recombinant protein (NP_620116) 10 ug
$3,255.00
LC408504 BAX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC408505 BAX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408504 Transient overexpression lysate of BCL2-associated X protein (BAX), transcript variant alpha 100 ug
$436.00
LY408505 Transient overexpression lysate of BCL2-associated X protein (BAX), transcript variant delta 100 ug
$436.00
TP750152 Purified recombinant protein of Human BCL2-associated X protein (BAX), transcript variant alpha, Met1-Gln171, with C-terminal HIS tag, expressed in E.Coli, 50 ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.