ARH3 (ADPRHL2) (NM_017825) Human Recombinant Protein

SKU
TP304342
Recombinant protein of human ADP-ribosylhydrolase like 2 (ADPRHL2), nuclear gene encoding mitochondrial protein, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204342 protein sequence
Red=Cloning site Green=Tags(s)

MAAAAMAAAAGGGAGAARSLSRFRGCLAGALLGDCVGSFYEAHDTVDLTSVLRHVQSLEPDPGTPGSERT
EALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAGVVTVFKKLLNPKCRDVFEPAR
AQFNGKGSYGNGGAMRVAGISLAYSSVQDVQKFARLSAQLTHASSLGYNGAILQALAVHLALQGESSSEH
FLKQLLGHMEDLEGDAQSVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESVPTA
IYCFLRCMEPDPEIPSAFNSLQRTLIYSISLGGDTDTIATMAGAIAGAYYGMDQVPESWQQSCEGYEETD
ILAQSLHRVFQKS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 38.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060295
Locus ID 54936
UniProt ID Q9NX46
Cytogenetics 1p34.3
RefSeq Size 1701
RefSeq ORF 1089
Synonyms ADPRHL2; ARH3; CONDSIAS
Summary This gene encodes a member of the ADP-ribosylglycohydrolase family. The encoded enzyme catalyzes the removal of ADP-ribose from ADP-ribosylated proteins. This enzyme localizes to the mitochondria, in addition to the nucleus and cytoplasm.[provided by RefSeq, Feb 2009]
Write Your Own Review
You're reviewing:ARH3 (ADPRHL2) (NM_017825) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304342 ADPRHL2 MS Standard C13 and N15-labeled recombinant protein (NP_060295) 10 ug
$3,255.00
LC402619 ADPRHL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402619 Transient overexpression lysate of ADP-ribosylhydrolase like 2 (ADPRHL2), nuclear gene encoding mitochondrial protein 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.