gamma Catenin (JUP) (NM_002230) Human Recombinant Protein
SKU
TP304209
Recombinant protein of human junction plakoglobin (JUP), transcript variant 1, 20 µg
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC204209 protein sequence
Red=Cloning site Green=Tags(s) MEVMNLMEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTTTYTQGVPPSQG DLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQATNLQRLAEPSQLLKSAIVHLINYQDDAELA TRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMGSPQLVAAVVRTMQNTSDLDTARCTTSILH NLSHHREGLLAIFKSGGIPALVRMLSSPVESVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKN NPKFLAITTDCLQLLAYGNQESKLIILANGGPQALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVE AGGMQALGKHLTSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTC NNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLN QPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGTQQPYTDGVRMEEIV EGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGASAPL MELLHSRNEGTATYAAAVLFRISEDKNPDYRKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGDDLDAT YRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 81.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | Surface Plasmon Ressonance (SPR) (PMID: 29178343) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_002221 |
Locus ID | 3728 |
UniProt ID | P14923 |
Cytogenetics | 17q21.2 |
RefSeq Size | 3508 |
RefSeq ORF | 2235 |
Synonyms | CTNNG; DP3; DPIII; PDGB; PG; PKGB |
Summary | This gene encodes a major cytoplasmic protein which is the only known constituent common to submembranous plaques of both desmosomes and intermediate junctions. This protein forms distinct complexes with cadherins and desmosomal cadherins and is a member of the catenin family since it contains a distinct repeating amino acid motif called the armadillo repeat. Mutation in this gene has been associated with Naxos disease. Alternative splicing occurs in this gene; however, not all transcripts have been fully described. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Acute myeloid leukemia, Arrhythmogenic right ventricular cardiomyopathy (ARVC), Pathways in cancer |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH304209 | JUP MS Standard C13 and N15-labeled recombinant protein (NP_002221) | 10 ug |
$3,255.00
|
|
LC400807 | JUP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC411834 | JUP HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400807 | Transient overexpression lysate of junction plakoglobin (JUP), transcript variant 1 | 100 ug |
$436.00
|
|
LY411834 | Transient overexpression lysate of junction plakoglobin (JUP), transcript variant 2 | 100 ug |
$436.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.