SH2D2A (NM_003975) Human Recombinant Protein

SKU
TP304162
Recombinant protein of human SH2 domain protein 2A (SH2D2A), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC204162 protein sequence
Red=Cloning site Green=Tags(s)

MEFPLAQICPQGSHEAPIPTFSTFQITDMTRRSCQNLGYTAASPQAPEAASSTGNAERAEEVPGEGSLFL
QAETRAWFQKTQAHWLLQHGAAPAWFHGFITRREAERLLEPKPQGCYLVRFSESAVTFVLTYRSRTCCRH
FLLAQLRDGRHVVLGEDSAHARLQDLLLHYTAHPLSPYGETLTEPLARQTPEPAGLSLRTEESNFGSKSQ
DPNPQYSPIIKQGQAPVPMQKEGAGEKEPSQLLRPKPPIPAKPQLPPEVYTIPVPRHRPAPRPKPSNPIY
NEPDEPIAFYAMGRGSPGEAPSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQNTGGSQLHSENSVIGQ
GPPLPHQPPPAWRHTLPHNLSRQVLQDRGQAWLPLGPPQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 42.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003966
Locus ID 9047
UniProt ID Q9NP31
Cytogenetics 1q23.1
RefSeq Size 1661
RefSeq ORF 1167
Synonyms F2771; SCAP; TSAD; VRAP
Summary This gene encodes an adaptor protein thought to function in T-cell signal transduction. A related protein in mouse is responsible for the activation of lymphocyte-specific protein-tyrosine kinase and functions in downstream signaling. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]
Protein Pathways VEGF signaling pathway
Write Your Own Review
You're reviewing:SH2D2A (NM_003975) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304162 SH2D2A MS Standard C13 and N15-labeled recombinant protein (NP_003966) 10 ug
$3,255.00
LC418322 SH2D2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431326 SH2D2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431347 SH2D2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431896 SH2D2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418322 Transient overexpression lysate of SH2 domain protein 2A (SH2D2A), transcript variant 2 100 ug
$436.00
LY431326 Transient overexpression lysate of SH2 domain containing 2A (SH2D2A), transcript variant 3 100 ug
$436.00
LY431347 Transient overexpression lysate of SH2 domain containing 2A (SH2D2A), transcript variant 1 100 ug
$436.00
LY431896 Transient overexpression lysate of SH2 domain containing 2A (SH2D2A), transcript variant 5 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.