SH2D2A (NM_003975) Human Mass Spec Standard

SKU
PH304162
SH2D2A MS Standard C13 and N15-labeled recombinant protein (NP_003966)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC204162]
Predicted MW 42.9 kDa
Protein Sequence
Protein Sequence
>RC204162 protein sequence
Red=Cloning site Green=Tags(s)

MEFPLAQICPQGSHEAPIPTFSTFQITDMTRRSCQNLGYTAASPQAPEAASSTGNAERAEEVPGEGSLFL
QAETRAWFQKTQAHWLLQHGAAPAWFHGFITRREAERLLEPKPQGCYLVRFSESAVTFVLTYRSRTCCRH
FLLAQLRDGRHVVLGEDSAHARLQDLLLHYTAHPLSPYGETLTEPLARQTPEPAGLSLRTEESNFGSKSQ
DPNPQYSPIIKQGQAPVPMQKEGAGEKEPSQLLRPKPPIPAKPQLPPEVYTIPVPRHRPAPRPKPSNPIY
NEPDEPIAFYAMGRGSPGEAPSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQNTGGSQLHSENSVIGQ
GPPLPHQPPPAWRHTLPHNLSRQVLQDRGQAWLPLGPPQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003966
RefSeq Size 1661
RefSeq ORF 1167
Synonyms F2771; SCAP; TSAD; VRAP
Locus ID 9047
UniProt ID Q9NP31
Cytogenetics 1q23.1
Summary This gene encodes an adaptor protein thought to function in T-cell signal transduction. A related protein in mouse is responsible for the activation of lymphocyte-specific protein-tyrosine kinase and functions in downstream signaling. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]
Protein Pathways VEGF signaling pathway
Write Your Own Review
You're reviewing:SH2D2A (NM_003975) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418322 SH2D2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431326 SH2D2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431347 SH2D2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431896 SH2D2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418322 Transient overexpression lysate of SH2 domain protein 2A (SH2D2A), transcript variant 2 100 ug
$436.00
LY431326 Transient overexpression lysate of SH2 domain containing 2A (SH2D2A), transcript variant 3 100 ug
$436.00
LY431347 Transient overexpression lysate of SH2 domain containing 2A (SH2D2A), transcript variant 1 100 ug
$436.00
LY431896 Transient overexpression lysate of SH2 domain containing 2A (SH2D2A), transcript variant 5 100 ug
$436.00
TP304162 Recombinant protein of human SH2 domain protein 2A (SH2D2A), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.