OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SH2D2A (NM_003975) Human Mass Spec Standard

Be the first to review this product
SKU
PH304162
SH2D2A MS Standard C13 and N15-labeled recombinant protein (NP_003966)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA504364 SH2D2A mouse monoclonal antibody, clone OTI4F3 (formerly 4F3) 100 ul
$447.00
LY418322 Transient overexpression lysate of SH2 domain protein 2A (SH2D2A), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "SH2D2A or NM_003975"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC204162
Predicted MW 42.9 kDa
Protein Sequence
Protein Sequence
>RC204162 protein sequence
Red=Cloning site Green=Tags(s)

MEFPLAQICPQGSHEAPIPTFSTFQITDMTRRSCQNLGYTAASPQAPEAASSTGNAERAEEVPGEGSLFL
QAETRAWFQKTQAHWLLQHGAAPAWFHGFITRREAERLLEPKPQGCYLVRFSESAVTFVLTYRSRTCCRH
FLLAQLRDGRHVVLGEDSAHARLQDLLLHYTAHPLSPYGETLTEPLARQTPEPAGLSLRTEESNFGSKSQ
DPNPQYSPIIKQGQAPVPMQKEGAGEKEPSQLLRPKPPIPAKPQLPPEVYTIPVPRHRPAPRPKPSNPIY
NEPDEPIAFYAMGRGSPGEAPSNIYVEVEDEGLPATLGHPVLRKSWSRPVPGGQNTGGSQLHSENSVIGQ
GPPLPHQPPPAWRHTLPHNLSRQVLQDRGQAWLPLGPPQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003966
RefSeq Size 1661
RefSeq ORF 1167
Synonyms F2771; SCAP; TSAD; VRAP
Locus ID 9047
UniProt ID Q9NP31
Cytogenetics 1q23.1
Summary This gene encodes an adaptor protein thought to function in T-cell signal transduction. A related protein in mouse is responsible for the activation of lymphocyte-specific protein-tyrosine kinase and functions in downstream signaling. Alternative splicing results in multiple transcript variants. provided by RefSeq, Mar 2010
Protein Pathways VEGF signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SH2D2A" proteins (9)
SKU Description Size Price
LC418322 Lyophilized SH2D2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431326 Lyophilized SH2D2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431347 Lyophilized SH2D2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431896 Lyophilized SH2D2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418322 Transient overexpression lysate of SH2 domain protein 2A (SH2D2A), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY431326 Transient overexpression lysate of SH2 domain containing 2A (SH2D2A), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY431347 Transient overexpression lysate of SH2 domain containing 2A (SH2D2A), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY431896 Transient overexpression lysate of SH2 domain containing 2A (SH2D2A), transcript variant 5 (as WB positive control) 100 ug
$436.00
TP304162 Recombinant protein of human SH2 domain protein 2A (SH2D2A), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products