GIMAP5 (NM_018384) Human Recombinant Protein

SKU
TP303978
Recombinant protein of human GTPase, IMAP family member 5 (GIMAP5), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203978 protein sequence
Red=Cloning site Green=Tags(s)

MGGFQRGKYGTMAEGRSEDNLSATPPALRIILVGKTGCGKSATGNSILGQPVFESKLRAQSVTRTCQVKT
GTWNGRKVLVVDTPSIFESQADTQELYKNIGDCYLLSAPGPHVLLLVIQLGRFTAQDTVAIRKVKEVFGT
GAMRHVVILFTHKEDLGGQALDDYVANTDNCSLKDLVRECERRYCAFNNWGSVEEQRQQQAELLAVIERL
GREREGSFHSNDLFLDAQLLQRTGAGACQEDYRQYQAKVEWQVEKHKQELRENESNWAYKALLRVKHLML
LHYEIFVFLLLCSILFFIIFLFIFHYI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 34.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060854
Locus ID 55340
UniProt ID Q96F15
Cytogenetics 7q36.1
RefSeq Size 1895
RefSeq ORF 921
Synonyms HIMAP3; IAN-5; IAN4; IAN4L1; IAN5; IMAP3; IROD
Summary This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. This gene encodes an antiapoptotic protein that functions in T-cell survival. Polymorphisms in this gene are associated with systemic lupus erythematosus. Read-through transcription exists between this gene and the neighboring upstream GIMAP1 (GTPase, IMAP family member 1) gene. [provided by RefSeq, Dec 2010]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:GIMAP5 (NM_018384) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303978 GIMAP5 MS Standard C13 and N15-labeled recombinant protein (NP_060854) 10 ug
$3,255.00
LC413083 GIMAP5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413083 Transient overexpression lysate of GTPase, IMAP family member 5 (GIMAP5) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.