Dynein (DYNLL2) (NM_080677) Human Recombinant Protein

SKU TP303913M

Recombinant protein of human dynein, light chain, LC8-type 2 (DYNLL2), 100 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203913 protein sequence; Red=Cloning site Green=Tags(s); ; MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHET; KHFIYFYLGQVAILLFKSG; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_542408
• Locus ID: 140735
• UniProt ID: Q96FJ2
• Cytogenetics: 17q22
• RefSeq Size: 1522
• RefSeq ORF: 267
• Synonyms: Dlc2; DNCL1B; RSPH22
• Summary: Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures (By similarity).[UniProtKB/Swiss-Prot Function]