Lipoprotein lipase (LPL) (NM_000237) Human Recombinant Protein

SKU
TP303766
Recombinant protein of human lipoprotein lipase (LPL), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
5 Days*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203766 representing NM_000237
Red=Cloning site Green=Tags(s)

MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGVAESVATCHFN
HSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEHYPVSAGYTKLVGQDVARFIN
WMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRITGLDPAGPNFEYAEAPSRLSPDDADFVDVLH
TFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLL
NEENPSKAYRCSSKEAFEKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFS
GTESETHTNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDW
WSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 50.3 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000228
Locus ID 4023
UniProt ID P06858
Cytogenetics 8p21.3
RefSeq Size 3747
RefSeq ORF 1425
Synonyms HDLCQ11; LIPD
Summary LPL encodes lipoprotein lipase, which is expressed in heart, muscle, and adipose tissue. LPL functions as a homodimer, and has the dual functions of triglyceride hydrolase and ligand/bridging factor for receptor-mediated lipoprotein uptake. Severe mutations that cause LPL deficiency result in type I hyperlipoproteinemia, while less extreme mutations in LPL are linked to many disorders of lipoprotein metabolism. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Alzheimer's disease, Glycerolipid metabolism, PPAR signaling pathway
Write Your Own Review
You're reviewing:Lipoprotein lipase (LPL) (NM_000237) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303766 LPL MS Standard C13 and N15-labeled recombinant protein (NP_000228) 10 ug
$3,255.00
LC400089 LPL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400089 Transient overexpression lysate of lipoprotein lipase (LPL) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.