UCHL5IP (HAUS7) (NM_017518) Human Recombinant Protein

SKU
TP303737
Recombinant protein of human UCHL5 interacting protein (UCHL5IP), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC203737 protein sequence
Red=Cloning site Green=Tags(s)

MGGARLGARNMAGQDAGCGRGGDDYSEDEGDSSVSRAAVEVFGKLKDLNCPFLEGLYITEPKTIQELLCS
PSEYRLEILEWMCTRVWPSLQDRFSSLKGVPTEVKIQEMTKLGHELMLCAPDDQELLKGCACAQKQLHFM
DQLLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPECDPWPLDMQPLLNKQSDDW
QWASASAKSEEEEKLAELARQLQESAAKLHALRTEYFAQHEQGAAAGAADISTLDQKLRLVTSDFHQLIL
AFLQVYDDELGECCQRPGPDLHPCGPIIQATHQNLTSYSQLLQVVMAVADTSAKAVETVKKQQGEQICWG
GSSSVMSLATKMNELMEK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 40.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_059988
Locus ID 55559
UniProt ID Q99871
Cytogenetics Xq28
RefSeq Size 1378
RefSeq ORF 1104
Synonyms UCHL5IP; UIP1
Summary This gene encodes a subunit of the augmin complex, which regulates centrosome and mitotic spindle integrity, and is necessary for the completion of cytokinesis. The encoded protein was identified by interaction with ubiquitin C-terminal hydrolase 37. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2012]
Write Your Own Review
You're reviewing:UCHL5IP (HAUS7) (NM_017518) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH303737 HAUS7 MS Standard C13 and N15-labeled recombinant protein (NP_059988) 10 ug
$3,255.00
LC413731 HAUS7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413731 Transient overexpression lysate of HAUS augmin-like complex, subunit 7 (HAUS7) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.